Clone FI02855 Report

Search the DGRC for FI02855

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:55
Vector:pFlc-1
Associated Gene/TranscriptCG13339-RA
Protein status:FI02855.pep: gold
Sequenced Size:644

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13339 2008-08-15 Release 5.9 accounting
CG13339 2008-12-18 5.12 accounting

Clone Sequence Records

FI02855.complete Sequence

644 bp assembled on 2008-07-24

GenBank Submission: BT032653

> FI02855.complete
ATTGTTTTTATATTCAAAACGCAAAAACATGGCAGAAACCACTGGTGTGC
AAATAAAACTGGAACAGCAAAACATCAAGGAGCGCCTGAATCTGCACGTC
AAGCGGCGCCTGCAGCAGGATGCGGATAATCCCGCCGAGAGTCCCGAATT
GCTGCCCACCGATGCGAATGCCAAGCGCAGCAAGACGAAAGATGTCTCAA
AACCAAGAAAACCCTACCAAAAACGGACAGAAAAACCGAAAACAGAGGCG
ACCAAGTGCAAGAAAGTTGGACAATTGGGCAGTCCGGCGGGTGAAGTGGA
TCCAATGGATGACCAGGAGACGGAAGGCTTTTCCCCGGAGGCGCCGGATG
GCAAATCCGCCAGACGGGATTGCTGCAAAAATGCCGACATCCTCAACATA
GTTTTGAACGCTAAGAAACGTAGTTTAATGCAGGATCCTGAAGTTCAGGC
CTTCTGGACCGAAATAACCAATTGCATAAAGGGCTGAAAGCTTAACTGAT
CATAAGGGTCATTAGATCATAAGGAAATATTGTTGATGTTCGGGATATTT
GTTATATGAACAACATTAAATATCTAATATTAGGGCTGTTGTACAAATAT
GTAAATAAAATAAAATAAGTGTTAATCCAAAAAAAAAAAAAAAA

FI02855.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13339-RA 708 CG13339-RA 76..708 1..633 3165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9712518..9712881 265..628 1820 100 Plus
chr2R 21145070 chr2R 9712201..9712466 1..266 1330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13825209..13825577 265..633 1845 100 Plus
2R 25286936 2R 13824892..13825157 1..266 1330 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13826408..13826776 265..633 1845 100 Plus
2R 25260384 2R 13826091..13826356 1..266 1330 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:52:31 has no hits.

FI02855.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:53:33 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9712201..9712466 1..266 100 -> Plus
chr2R 9712520..9712881 267..628 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:15 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 1..459 29..487 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:30 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 1..459 29..487 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:37 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 1..459 29..487 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:15 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 1..459 29..487 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:03 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 1..459 29..487 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:38 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 1..628 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:30 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 1..628 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:37 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 35..662 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:45:58 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 1..628 1..628 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:03 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
CG13339-RA 35..662 1..628 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:33 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13825211..13825572 267..628 100   Plus
2R 13824892..13825157 1..266 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:33 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13825211..13825572 267..628 100   Plus
2R 13824892..13825157 1..266 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:33 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13825211..13825572 267..628 100   Plus
2R 13824892..13825157 1..266 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:37 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9712397..9712662 1..266 100 -> Plus
arm_2R 9712716..9713077 267..628 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:16 Download gff for FI02855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13826091..13826356 1..266 100 -> Plus
2R 13826410..13826771 267..628 100   Plus

FI02855.pep Sequence

Translation from 1 to 486

> FI02855.pep
LFLYSKRKNMAETTGVQIKLEQQNIKERLNLHVKRRLQQDADNPAESPEL
LPTDANAKRSKTKDVSKPRKPYQKRTEKPKTEATKCKKVGQLGSPAGEVD
PMDDQETEGFSPEAPDGKSARRDCCKNADILNIVLNAKKRSLMQDPEVQA
FWTEITNCIKG*

FI02855.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13712-PA 159 GF13712-PA 1..158 10..160 411 58.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20403-PA 152 GG20403-PA 1..152 10..161 691 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21036-PA 167 GH21036-PA 20..167 21..161 338 55 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13339-PA 152 CG13339-PA 1..152 10..161 795 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18638-PA 166 GI18638-PA 20..166 21..161 337 51.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17475-PA 152 GL17475-PA 5..151 16..160 423 67.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12218-PA 152 GA12218-PA 5..151 16..160 423 67.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21491-PA 152 GM21491-PA 1..152 10..161 791 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10985-PA 152 GD10985-PA 1..152 10..161 790 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21651-PA 166 GJ21651-PA 20..165 21..160 342 53 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17858-PA 168 GK17858-PA 7..166 15..159 272 47.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12563-PA 152 GE12563-PA 1..152 10..161 716 88.8 Plus

FI02855.hyp Sequence

Translation from 1 to 486

> FI02855.hyp
LFLYSKRKNMAETTGVQIKLEQQNIKERLNLHVKRRLQQDADNPAESPEL
LPTDANAKRSKTKDVSKPRKPYQKRTEKPKTEATKCKKVGQLGSPAGEVD
PMDDQETEGFSPEAPDGKSARRDCCKNADILNIVLNAKKRSLMQDPEVQA
FWTEITNCIKG*

FI02855.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13339-PA 152 CG13339-PA 1..152 10..161 795 100 Plus