Clone FI02856 Report

Search the DGRC for FI02856

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:56
Vector:pFlc-1
Associated Gene/TranscriptCG9336-RA
Protein status:FI02856.pep: gold
Sequenced Size:691

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9336 2008-08-15 Release 5.9 accounting
CG9336 2008-12-18 5.12 accounting

Clone Sequence Records

FI02856.complete Sequence

691 bp assembled on 2008-07-25

GenBank Submission: BT032654

> FI02856.complete
AGACGTGCAGCAGACATCGTTGACGGCGGTTGATAATCGTGCCTGACTTT
AAAAAAAAAAATCGTTTTCGAAAAGCAATTCCCACACTCGAAGTATTCGC
GAAAATGGTGTCCGCTCTGAAATGCAGTTTGGCCGTGGCCGTTATGATCA
GTCTGGCTTGTTCGGCCTACGCCATCAAGTGCTACCAGTGCGAGTCCCTC
ACAATGCCCAAGTGTGGCCTGAAGTTCGAGGCTGATGAGACGTTGCTGCT
GGACTGCTCCAGGATCGGACCCCCACGCTACCTGCAGAACTTCTTCCCCC
TGCGGAACGCCACTGGTTGCATGAAGAAGACCCTCGAAAGCGTGGCCGGA
CATCCGCAGATCGTGAGGAGCTGCTACTTCGGGGACATCAACAATATCCA
AGCTGGCTGCCAGTCGGATCCCTCTATGCCGTTCGTTAAGCAGCTGGGCT
GCGATGTCTGCACCAAGGACGAGTGCAACGGATCCTCCTCCCTGGCCCCC
ATCGCCGGAGCCATCCTGCTCTTCTTCGGCGTGGCTCGTCTGCTGGCCTA
GATCTTAACTAGCTAGTAAATTACCTGTGCGTAGTATTTAACGATCTTGT
TCTCTGGAAATTTCTTCTAAATTTGTTTTAATAATAAATGCACGACGAAT
GGTTGTCATAGCAACATGCCAAACTAAAAAAAAAAAAAAAA

FI02856.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG9336.d 836 CG9336.d 142..817 1..676 3380 100 Plus
CG9336-RA 840 CG9336-RA 93..768 1..676 3380 100 Plus
CG9336.a 1198 CG9336.a 133..474 1..342 1710 100 Plus
CG9336.a 1198 CG9336.a 873..1198 342..667 1630 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20859209..20859542 342..675 1625 99.1 Plus
chr2L 23010047 chr2L 20858259..20858436 165..342 890 100 Plus
chr2L 23010047 chr2L 20857700..20857862 1..165 760 98.8 Plus
chr2L 23010047 chr2L 20865481..20865676 354..549 350 78.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20860681..20861015 342..676 1675 100 Plus
2L 23513712 2L 20859724..20859901 165..342 890 100 Plus
2L 23513712 2L 20859169..20859333 1..165 825 100 Plus
2L 23513712 2L 20866947..20867142 354..549 350 78.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20860681..20861015 342..676 1675 100 Plus
2L 23513712 2L 20859724..20859901 165..342 890 100 Plus
2L 23513712 2L 20859169..20859333 1..165 825 100 Plus
2L 23513712 2L 20867036..20867142 443..549 340 87.8 Plus
2L 23513712 2L 20865496..20865583 250..337 170 79.5 Plus
Blast to na_te.dros performed on 2019-03-15 18:39:25 has no hits.

FI02856.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:40:20 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20857700..20857862 1..165 98 -> Plus
chr2L 20858260..20858436 166..342 100 -> Plus
chr2L 20859210..20859542 343..675 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:16 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 1..447 105..551 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:54 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 1..447 105..551 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:26:22 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 1..447 105..551 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:13 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 1..447 105..551 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:56:05 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 1..447 105..551 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:17 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 1..675 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:54 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 1..675 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:26:22 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 4..678 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:26 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 1..675 1..675 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:56:05 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 4..678 1..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:20 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20859169..20859333 1..165 100 -> Plus
2L 20859725..20859901 166..342 100 -> Plus
2L 20860682..20861014 343..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:20 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20859169..20859333 1..165 100 -> Plus
2L 20859725..20859901 166..342 100 -> Plus
2L 20860682..20861014 343..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:20 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20859169..20859333 1..165 100 -> Plus
2L 20859725..20859901 166..342 100 -> Plus
2L 20860682..20861014 343..675 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:26:22 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20859169..20859333 1..165 100 -> Plus
arm_2L 20859725..20859901 166..342 100 -> Plus
arm_2L 20860682..20861014 343..675 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:48 Download gff for FI02856.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20860682..20861014 343..675 100   Plus
2L 20859169..20859333 1..165 100 -> Plus
2L 20859725..20859901 166..342 100 -> Plus

FI02856.pep Sequence

Translation from 104 to 550

> FI02856.pep
MVSALKCSLAVAVMISLACSAYAIKCYQCESLTMPKCGLKFEADETLLLD
CSRIGPPRYLQNFFPLRNATGCMKKTLESVAGHPQIVRSCYFGDINNIQA
GCQSDPSMPFVKQLGCDVCTKDECNGSSSLAPIAGAILLFFGVARLLA*

FI02856.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20975-PA 148 GF20975-PA 1..148 1..148 715 89.9 Plus
Dana\GF20986-PA 148 GF20986-PA 1..148 1..148 528 67.6 Plus
Dana\GF20997-PA 152 GF20997-PA 6..132 9..135 266 40.6 Plus
Dana\GF21008-PA 145 GF21008-PA 18..139 20..143 165 33.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21263-PA 148 GG21263-PA 1..148 1..148 746 94.6 Plus
Dere\GG21264-PA 147 GG21264-PA 1..147 1..148 524 64.2 Plus
Dere\GG21268-PA 147 GG21268-PA 3..147 9..148 367 51 Plus
Dere\GG21267-PA 152 GG21267-PA 1..152 1..148 351 48.7 Plus
Dere\GG10978-PA 159 GG10978-PA 1..140 1..134 339 48.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10591-PA 148 GH10591-PA 1..148 1..148 719 88.5 Plus
Dgri\GH10592-PA 148 GH10592-PA 1..148 1..148 607 73.6 Plus
Dgri\GH10593-PA 153 GH10593-PA 18..126 22..130 221 39.1 Plus
Dgri\GH10594-PA 147 GH10594-PA 22..141 24..140 162 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9336-PA 148 CG9336-PA 1..148 1..148 782 100 Plus
CG9336-PB 115 CG9336-PB 1..115 34..148 617 100 Plus
CG9338-PB 147 CG9338-PB 1..147 1..148 524 62.8 Plus
CG9338-PA 147 CG9338-PA 1..147 1..148 524 62.8 Plus
CG31675-PA 148 CG31675-PA 6..148 9..147 267 40.3 Plus
CG14401-PA 146 CG14401-PA 2..145 4..148 214 36 Plus
CG14401-PC 150 CG14401-PC 2..149 4..148 200 35.1 Plus
CG14401-PB 198 CG14401-PB 74..197 23..148 193 36.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23198-PA 148 GI23198-PA 1..148 1..148 689 84.5 Plus
Dmoj\GI23209-PA 148 GI23209-PA 1..148 1..148 556 75 Plus
Dmoj\GI23220-PA 153 GI23220-PA 20..125 24..129 237 39.3 Plus
Dmoj\GI23230-PA 148 GI23230-PA 19..146 20..140 183 35.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25347-PA 148 GL25347-PA 1..148 1..148 729 90.5 Plus
Dper\GL18529-PA 148 GL18529-PA 1..148 1..148 615 73 Plus
Dper\GL18528-PA 115 GL18528-PA 1..115 34..148 579 90.4 Plus
Dper\GL18530-PA 150 GL18530-PA 17..127 20..130 239 40.2 Plus
Dper\GL18531-PA 150 GL18531-PA 1..131 5..132 179 29.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21711-PA 146 GA21711-PA 19..146 21..148 650 90.6 Plus
Dpse\GA25674-PA 148 GA25674-PA 1..148 1..148 615 73 Plus
Dpse\GA16386-PA 150 GA16386-PA 17..127 20..130 239 40.2 Plus
Dpse\GA25675-PA 150 GA25675-PA 1..131 5..132 179 29.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23380-PA 148 GM23380-PA 1..148 1..148 739 95.9 Plus
Dsec\GM23382-PA 141 GM23382-PA 3..141 9..148 519 65.7 Plus
Dsec\GM23383-PA 148 GM23383-PA 6..148 9..147 261 38.9 Plus
Dsec\GM23384-PA 146 GM23384-PA 12..127 13..131 183 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24290-PA 148 GD24290-PA 1..148 1..148 774 100 Plus
Dsim\GD24291-PA 245 GD24291-PA 120..245 22..148 496 68.5 Plus
Dsim\GD24292-PA 148 GD24292-PA 6..148 9..147 263 39.6 Plus
Dsim\GD24293-PA 146 GD24293-PA 12..127 13..131 181 35.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23697-PA 148 GJ23697-PA 1..148 1..148 727 91.2 Plus
Dvir\GJ23708-PA 148 GJ23708-PA 1..148 1..148 593 76.4 Plus
Dvir\GJ23718-PA 265 GJ23718-PA 5..125 9..129 240 37.7 Plus
Dvir\GJ23718-PA 265 GJ23718-PA 142..253 26..138 172 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15441-PA 149 GK15441-PA 1..149 1..148 613 75.2 Plus
Dwil\GK15443-PA 148 GK15443-PA 1..148 1..148 597 72.3 Plus
Dwil\GK15444-PA 148 GK15444-PA 1..148 1..148 519 64.9 Plus
Dwil\GK15445-PA 125 GK15445-PA 12..125 13..127 228 41.4 Plus
Dwil\GK15446-PA 151 GK15446-PA 8..133 9..129 207 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12885-PA 148 GE12885-PA 1..148 1..148 751 95.3 Plus
Dyak\GE12886-PA 147 GE12886-PA 1..147 1..148 521 62.8 Plus
Dyak\GE12887-PA 148 GE12887-PA 6..148 9..147 264 40.3 Plus
Dyak\GE12888-PA 147 GE12888-PA 3..129 1..133 201 35.3 Plus

FI02856.hyp Sequence

Translation from 104 to 550

> FI02856.hyp
MVSALKCSLAVAVMISLACSAYAIKCYQCESLTMPKCGLKFEADETLLLD
CSRIGPPRYLQNFFPLRNATGCMKKTLESVAGHPQIVRSCYFGDINNIQA
GCQSDPSMPFVKQLGCDVCTKDECNGSSSLAPIAGAILLFFGVARLLA*

FI02856.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG9336-PA 148 CG9336-PA 1..148 1..148 782 100 Plus
CG9336-PB 115 CG9336-PB 1..115 34..148 617 100 Plus
CG9338-PB 147 CG9338-PB 1..147 1..148 524 62.8 Plus
CG9338-PA 147 CG9338-PA 1..147 1..148 524 62.8 Plus
CG31675-PA 148 CG31675-PA 6..148 9..147 267 40.3 Plus