Clone FI02857 Report

Search the DGRC for FI02857

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:57
Vector:pFlc-1
Associated Gene/TranscriptCG8111-RA
Protein status:FI02857.pep: gold
Sequenced Size:1341

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8111 2008-12-18 5.12 accounting

Clone Sequence Records

FI02857.complete Sequence

1341 bp assembled on 2008-09-15

GenBank Submission: BT044487.1

> FI02857.complete
AAGCTGTTGCCGGAACTTATTTATAGCCTGCGTTCCACAGATGGTAAATC
CATCCAGGATCGCCCGAATCGATGGCATCTCTGAGCGAAACACTTCGTAG
CCACTGGCCCATCGCTTTGTTCGGTGTGATCCTCTTCGTGGCTGGGGGCA
CGGAGCTCTACTGGAACGAGGGACGAGCCGTGCACAATATGATGGCGCTG
GACGAGGCACACGCCGACATCTACTCGGTGCGCTTCACGGAGGAGGAACA
GGAGGTGGGCCTCGAGGGCAGAATCGTTCACCTATCCGGACCCATTCTCG
TGGGCGAACCGCTCACCGAACCCGACTACAACATTCAGTTGCTGGCGGTG
AAGCTCCGGCGACGCGTCCAAATGTACCAGTGGGTCGAGGAGGCGGTCGA
GCACAACTACGGCGACAGCGTGGGAACGACGCATTCGGACTCCCGCACCT
ACTATTACACGCGGGAATGGCGTGATAAGATCGTGGACTCGCGAAACTTC
TACAACCGCCACGGACACACGAATCCCAGTCACTTTCCCATCGAAAGCCA
CGTTCAGGTGGCGGATGCCGTCTTCATTGGACGCTATGAACTGGGTGCGG
AGGTGAAGGAGAAGTTTAACAACTACCAGGAGCTCACTTCGGACATTCGG
CCAGAGGATAGTGGCGTCAAGCTGCATCTGGGCATATATTATCACACCAA
TGATGTGTTCAATCCGGAGGTGGGTGACCTGCGCCTGCTCTTCAGCTTCG
CGGGAATGGAGGGCGAGGTGTTCAGCGTGGTGGGCAAGCTGTCGGGCAAC
AAACTGGTGCCGTACATAACCTCCCGTGGCGTTCCAGTGCTGCTCGTCTA
TCCGGGTGGGCTCAGTGTCCAGGAAGTGTTCCGGTTGGAGGCTCGTGCCC
AGGTCTTGCACACCTGGTGGTGGCGCTTCGTCGGCTGGCTGCTGATCTTC
TTCGGCGTCACCTGCAACACCAAAATCCTTCGTCTGCTGTTTGTACGGGT
GCCGCTATTGGTGGCCTTGGCACCCGATCCTCAGTTCCCGGTTACGGGCA
ACCTACTCATCGCATTTTCGCTAGCTCTGACCATTGCGGCAGTCGCCTGG
ATCCTGCATCGTCCTGTGATCGGCGCCTGCCTCTTACTGGCTGGCGCATC
GCCTTACGTCTGGTTCACCCGCAATCTGGTCGACTACCATCGCCTGGACT
AATCCATTTCAGAGTCATCTCAATATTATTTACAGGTTTATTTATTGTTG
ATTTTCATTGTTGAGCCAAATTGATCGCATTTGCCATTTATCCCTCGGCC
AATAAAAACTTAACACTTAGTAACCAAAAAAAAAAAAAAAA

FI02857.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8111-RA 1435 CG8111-RA 109..1435 2..1328 6620 99.9 Plus
CG8111.a 1364 CG8111.a 40..1364 2..1328 6565 99.7 Plus
CG8281-RA 1294 CG8281-RA 1198..1294 1328..1232 470 98.9 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7906173..7906765 990..398 2860 98.8 Minus
chr3L 24539361 chr3L 7906822..7907217 397..2 1950 99.5 Minus
chr3L 24539361 chr3L 7905781..7906112 1324..991 1560 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7914059..7914651 990..398 2965 100 Minus
3L 28110227 3L 7914708..7915103 397..2 1980 100 Minus
3L 28110227 3L 7913660..7913997 1328..991 1675 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7907159..7907751 990..398 2965 100 Minus
3L 28103327 3L 7907808..7908203 397..2 1980 100 Minus
3L 28103327 3L 7906760..7907097 1328..991 1675 99.7 Minus
Blast to na_te.dros performed 2019-03-16 00:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1a 5108 Rt1a DME278684 5108bp Derived from AJ278684 (AJ278684.1) (Rel. 64, Last updated, Version 1). 3069..3098 143..114 114 86.7 Minus

FI02857.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:00:21 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7905780..7906112 991..1325 98 <- Minus
chr3L 7906173..7906765 398..990 98 <- Minus
chr3L 7906822..7907217 1..397 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:17 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 1..1131 72..1202 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:01:33 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 1..1131 72..1202 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:59 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 1..1131 72..1202 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:18:57 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 1..1131 72..1202 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:19:58 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 13..1336 1..1325 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:01:32 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 15..1338 1..1324 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:59 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 17..1340 1..1324 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-15 12:13:50 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 13..1336 1..1325 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:18:57 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 17..1340 1..1324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:21 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7913663..7913997 991..1325 99 <- Minus
3L 7914059..7914651 398..990 100 <- Minus
3L 7914708..7915103 1..397 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:21 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7913663..7913997 991..1325 99 <- Minus
3L 7914059..7914651 398..990 100 <- Minus
3L 7914708..7915103 1..397 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:00:21 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7913663..7913997 991..1325 99 <- Minus
3L 7914059..7914651 398..990 100 <- Minus
3L 7914708..7915103 1..397 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:59 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7907808..7908203 1..397 99   Minus
arm_3L 7906763..7907097 991..1325 99 <- Minus
arm_3L 7907159..7907751 398..990 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:29:00 Download gff for FI02857.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7906763..7907097 991..1325 99 <- Minus
3L 7907159..7907751 398..990 100 <- Minus
3L 7907808..7908203 1..397 99   Minus

FI02857.hyp Sequence

Translation from 71 to 1201

> FI02857.hyp
MASLSETLRSHWPIALFGVILFVAGGTELYWNEGRAVHNMMALDEAHADI
YSVRFTEEEQEVGLEGRIVHLSGPILVGEPLTEPDYNIQLLAVKLRRRVQ
MYQWVEEAVEHNYGDSVGTTHSDSRTYYYTREWRDKIVDSRNFYNRHGHT
NPSHFPIESHVQVADAVFIGRYELGAEVKEKFNNYQELTSDIRPEDSGVK
LHLGIYYHTNDVFNPEVGDLRLLFSFAGMEGEVFSVVGKLSGNKLVPYIT
SRGVPVLLVYPGGLSVQEVFRLEARAQVLHTWWWRFVGWLLIFFGVTCNT
KILRLLFVRVPLLVALAPDPQFPVTGNLLIAFSLALTIAAVAWILHRPVI
GACLLLAGASPYVWFTRNLVDYHRLD*

FI02857.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8111-PA 376 CG8111-PA 1..376 1..376 1990 100 Plus

FI02857.pep Sequence

Translation from 71 to 1201

> FI02857.pep
MASLSETLRSHWPIALFGVILFVAGGTELYWNEGRAVHNMMALDEAHADI
YSVRFTEEEQEVGLEGRIVHLSGPILVGEPLTEPDYNIQLLAVKLRRRVQ
MYQWVEEAVEHNYGDSVGTTHSDSRTYYYTREWRDKIVDSRNFYNRHGHT
NPSHFPIESHVQVADAVFIGRYELGAEVKEKFNNYQELTSDIRPEDSGVK
LHLGIYYHTNDVFNPEVGDLRLLFSFAGMEGEVFSVVGKLSGNKLVPYIT
SRGVPVLLVYPGGLSVQEVFRLEARAQVLHTWWWRFVGWLLIFFGVTCNT
KILRLLFVRVPLLVALAPDPQFPVTGNLLIAFSLALTIAAVAWILHRPVI
GACLLLAGASPYVWFTRNLVDYHRLD*

FI02857.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10634-PA 376 GF10634-PA 1..376 1..376 1803 89.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14931-PA 376 GG14931-PA 1..376 1..376 1891 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16511-PA 376 GH16511-PA 1..376 1..376 1526 74.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG8111-PA 376 CG8111-PA 1..376 1..376 1990 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12188-PA 375 GI12188-PA 1..375 1..376 1617 77.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17821-PA 376 GL17821-PA 1..376 1..376 1637 81.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20832-PA 376 GA20832-PA 1..376 1..376 1637 81.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24982-PA 376 GM24982-PA 1..376 1..376 1927 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13030-PA 376 GD13030-PA 1..376 1..376 1949 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11423-PA 375 GJ11423-PA 1..375 1..376 1671 80.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17739-PA 373 GK17739-PA 1..373 1..376 1631 76.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20383-PA 376 GE20383-PA 1..376 1..376 1929 96 Plus