Clone FI02869 Report

Search the DGRC for FI02869

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:69
Vector:pFlc-1
Associated Gene/TranscriptCG9548-RA
Protein status:FI02869.pep: gold
Sequenced Size:482

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9548 2008-08-15 Release 5.9 accounting
CG9548 2008-12-18 5.12 accounting

Clone Sequence Records

FI02869.complete Sequence

482 bp assembled on 2008-08-06

GenBank Submission: BT044121.1

> FI02869.complete
GACACTATAAAGAAGTCGCCGCTTTTTCAGCAACTGTTTTTATATTTGCT
GACTGAAAACTAATATTAAATCATGGCCAAACATCATCCGGATTTGATTT
TCTGCCGCAAGCAGCCCGGCGTGGCCATTGGACGCCTGTGTGAAAAAGAC
GATGGAAAGTGTGTGATCTGCGACTCCTACGTGCGGCCATGCACACTGGT
GCGGATCTGCGACGAGTGCAACTACGGATCCTACCAGGGCAGGTGCGTCA
TCTGTGGAGGACCCGGAGTGTCGGATGCCTACTACTGCAAGTCCTGCACC
ATTCAGGAAAAGGACCGCGACGGATGCCCCAAGATTGTAAATCTAGGCAG
CTCCAAGACTGACCTGTTCTACGAACGCAAGAAATATGGCTTCAAACAGA
ACTATTAATCTGCTCTCCGCTACCTCAATACATTTCTAATAAATTTTTAT
TGTAGTTTAATACATGAAAAAAAAAAAAAAAA

FI02869.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG9548-RA 538 CG9548-RA 67..538 2..473 2345 99.7 Plus
epsilonCOP-RA 1104 epsilonCOP-RA 1060..1104 473..429 210 97.7 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6489421..6489612 315..124 915 98.4 Minus
chr2L 23010047 chr2L 6489689..6489811 124..2 615 100 Minus
chr2L 23010047 chr2L 6489270..6489355 401..316 430 100 Minus
chr2L 23010047 chr2L 6489140..6489204 466..402 325 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6490439..6490630 315..124 960 100 Minus
2L 23513712 2L 6490706..6490828 124..2 615 100 Minus
2L 23513712 2L 6490288..6490373 401..316 430 100 Minus
2L 23513712 2L 6490151..6490222 473..402 345 98.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6490439..6490630 315..124 960 100 Minus
2L 23513712 2L 6490706..6490828 124..2 615 100 Minus
2L 23513712 2L 6490288..6490373 401..316 430 100 Minus
2L 23513712 2L 6490151..6490222 473..402 345 98.6 Minus
Blast to na_te.dros performed on 2019-03-16 01:13:52 has no hits.

FI02869.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:14:46 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6489140..6489204 402..466 100 <- Minus
chr2L 6489270..6489355 316..401 100 <- Minus
chr2L 6489421..6489611 125..315 98 <- Minus
chr2L 6489689..6489811 1..124 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:34 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 1..336 73..408 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:39:15 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 1..336 73..408 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:29 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 1..336 73..408 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:17:49 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 1..336 73..408 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:28:01 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 1..336 73..408 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:08:37 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 1..465 2..466 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:39:15 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 1..465 2..466 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:29 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 15..480 1..466 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-06 16:09:10 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 1..465 2..466 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:28:01 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
CG9548-RA 15..480 1..466 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:46 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6490158..6490222 402..466 100 <- Minus
2L 6490288..6490373 316..401 100 <- Minus
2L 6490439..6490629 125..315 100 <- Minus
2L 6490706..6490828 1..124 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:46 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6490158..6490222 402..466 100 <- Minus
2L 6490288..6490373 316..401 100 <- Minus
2L 6490439..6490629 125..315 100 <- Minus
2L 6490706..6490828 1..124 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:46 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6490158..6490222 402..466 100 <- Minus
2L 6490288..6490373 316..401 100 <- Minus
2L 6490439..6490629 125..315 100 <- Minus
2L 6490706..6490828 1..124 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:29 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6490288..6490373 316..401 100 <- Minus
arm_2L 6490439..6490629 125..315 100 <- Minus
arm_2L 6490706..6490828 1..124 99   Minus
arm_2L 6490158..6490222 402..466 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:34 Download gff for FI02869.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6490158..6490222 402..466 100 <- Minus
2L 6490288..6490373 316..401 100 <- Minus
2L 6490439..6490629 125..315 100 <- Minus
2L 6490706..6490828 1..124 99   Minus

FI02869.pep Sequence

Translation from 72 to 407

> FI02869.pep
MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECN
YGSYQGRCVICGGPGVSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFY
ERKKYGFKQNY*

FI02869.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15704-PA 111 GF15704-PA 1..111 1..111 569 99.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23616-PA 111 GG23616-PA 1..111 1..111 576 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13247-PA 110 GH13247-PA 1..110 1..110 564 99.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Phf5a-PA 111 CG9548-PA 1..111 1..111 633 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17286-PA 110 GI17286-PA 1..110 1..110 564 99.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26100-PA 111 GL26100-PA 1..111 1..111 573 99.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21871-PA 110 GA21871-PA 1..110 1..110 562 98.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17932-PA 111 GM17932-PA 1..111 1..111 576 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22570-PA 111 GD22570-PA 1..111 1..111 576 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17895-PA 110 GJ17895-PA 1..110 1..110 564 99.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18690-PA 111 GK18690-PA 1..111 1..111 576 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18435-PA 111 GE18435-PA 1..111 1..111 576 100 Plus

FI02869.hyp Sequence

Translation from 72 to 407

> FI02869.hyp
MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECN
YGSYQGRCVICGGPGVSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFY
ERKKYGFKQNY*

FI02869.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG9548-PA 111 CG9548-PA 1..111 1..111 633 100 Plus