Clone FI02883 Report

Search the DGRC for FI02883

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:83
Vector:pFlc-1
Associated Gene/TranscriptSgt1-RA
Protein status:FI02883.pep: gold
Sequenced Size:1108

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9617 2008-08-15 Release 5.9 accounting
CG9617 2008-12-18 5.12 accounting

Clone Sequence Records

FI02883.complete Sequence

1108 bp assembled on 2008-07-08

GenBank Submission: BT044125.1

> FI02883.complete
GATTTTTATATCTGGTAGCACTGCCTTTAGTCACATTCATTTGTATTGAA
TTCTAGATAATTCCAGATAATAATAAAATTAACCCCGTTTAGTGGGCGAA
AGCAATTATAGGGGAATCCTCAACAATTCCCAATTTCCAGTACCAGCTGA
AGCAGCAAGATGTCCGTGCGCCACGACTGGTACCAGTCGGAGACCAAGGT
GGTCATCACCGTGCTCCTGAAGAACGCCGTCGATAAGAACTATGCTGTGG
AGATTACCCAGAAGCGAGTCCACATGACGGCGGATGGCTACGAGTTGGAC
CTGAAGCTGCTTCATCCCATTGTTGTGGAGCGTTCCTCCTACAAGGCCTT
TTCGACCAAAGTGGAAATCACACTGGCTAAGGAGACGGGAATTCGGTGGG
AGAATCTGGAGGAGGCCATCGTGGCTGCACCGGTGAAACCCAAGGCCAAG
AACTGGGACCAGCTGGTCAGCGAGGAGGAAAAGATCGACGAGAAGGAGGC
CAAGGGCGAGGCGGCCCTCACCAACCTGTTCAAGAAAATCTACAGCTCAT
CCTCGCCCGAGGTCCAAAAGGCCATGAACAAGTCCTTCTCGGAGTCCGGA
GGCACCGTGCTCAGCACCAACTGGAATGAGGTGGGCAAAGAAAGAGTCAC
CGTGAAGCCTCCAAATGGAACCGAGTTCCGCGAGTGGGAGAAGTAGGCGA
AATGGCCATACTCCTTTATTTATAGAGTCAGCGAGAGAGATTAACAGAGA
ATAATTACTATAACGTGTACATTTTGGGGATTGTCGACTTGAATTAGCAA
GTACAGAGGAGTATCATAAGGAAAACAGTGGCAATAAACGCATTAAAGGA
ACTTCAGAAACACAAAAATGTTTATATTTCCTAGAAAAGAACTAGGCTGT
AAAATAAATTAATGAATCCACCACATAAACACTCTTTCGAGCACCTCACA
ACATAAATGTATTTTAATTAATATTTTGTTATATCATAGCACTTTATTTC
TGTAACAAGTTTGGTTAAAACACTCGACAGAATAAGATTTGGATAATGTA
TGTATTTAATTTGTAACGAATAAATTTAAATCAACAGTTTTCAAAAAAAA
AAAAAAAA

FI02883.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Sgt1-RA 1090 Sgt1-RA 2..1090 4..1092 5445 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4130210..4131298 1092..4 5310 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8304188..8305278 1094..4 5455 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8045019..8046109 1094..4 5455 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:40:36 has no hits.

FI02883.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:41:51 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4130210..4131299 1..1092 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:49 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9617-RA 1..537 160..696 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:13 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
Sgt1-RA 1..537 160..696 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:20 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
Sgt1-RA 1..537 160..696 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:52:33 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9617-RA 1..537 160..696 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:39:13 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
Sgt1-RA 1..537 160..696 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:28:05 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9617-RA 1..1069 24..1092 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:13 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
Sgt1-RA 2..1090 4..1092 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:20 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
Sgt1-RA 1..1085 8..1092 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:52:34 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
CG9617-RA 1..1069 24..1092 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:39:13 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
Sgt1-RA 1..1085 8..1092 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:41:51 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8304190..8305279 1..1092 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:41:51 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8304190..8305279 1..1092 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:41:51 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8304190..8305279 1..1092 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:20 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4129912..4131001 1..1092 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:33:47 Download gff for FI02883.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8045021..8046110 1..1092 99   Minus

FI02883.pep Sequence

Translation from 159 to 695

> FI02883.pep
MSVRHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHMTADGYELDLKL
LHPIVVERSSYKAFSTKVEITLAKETGIRWENLEEAIVAAPVKPKAKNWD
QLVSEEEKIDEKEAKGEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTV
LSTNWNEVGKERVTVKPPNGTEFREWEK*

FI02883.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16673-PA 182 GF16673-PA 1..182 1..178 753 80.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17461-PA 179 GG17461-PA 1..179 1..178 856 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18912-PA 179 GH18912-PA 1..179 1..178 715 78.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Sgt1-PA 178 CG9617-PA 1..178 1..178 912 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23411-PA 180 GI23411-PA 1..180 1..178 724 78.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18161-PA 181 GL18161-PA 1..181 1..178 653 75.8 Plus
Dper\GL24124-PA 181 GL24124-PA 1..181 1..178 652 75.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26510-PA 181 GA26510-PA 1..181 1..178 658 76.4 Plus
Dpse\GA21916-PA 181 GA21916-PA 1..181 1..178 657 76.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26355-PA 178 GM26355-PA 1..178 1..178 901 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20877-PA 178 GD20877-PA 1..178 1..178 897 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10617-PA 180 GJ10617-PA 1..180 1..178 705 80.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11706-PA 181 GK11706-PA 1..181 1..178 640 74.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24860-PA 179 GE24860-PA 1..179 1..178 848 91.1 Plus

FI02883.hyp Sequence

Translation from 159 to 695

> FI02883.hyp
MSVRHDWYQSETKVVITVLLKNAVDKNYAVEITQKRVHMTADGYELDLKL
LHPIVVERSSYKAFSTKVEITLAKETGIRWENLEEAIVAAPVKPKAKNWD
QLVSEEEKIDEKEAKGEAALTNLFKKIYSSSSPEVQKAMNKSFSESGGTV
LSTNWNEVGKERVTVKPPNGTEFREWEK*

FI02883.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Sgt1-PA 178 CG9617-PA 1..178 1..178 912 100 Plus