Clone FI02884 Report

Search the DGRC for FI02884

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:84
Vector:pFlc-1
Associated Gene/TranscriptCG14977-RA
Protein status:FI02884.pep: gold
Sequenced Size:561

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14977 2008-08-15 Release 5.9 accounting
CG14977 2008-12-18 5.12 accounting

Clone Sequence Records

FI02884.complete Sequence

561 bp assembled on 2008-07-25

GenBank Submission: BT032657

> FI02884.complete
GACTGGTGGGTGTGGGTGCGAAAGATAAATAAATAAATATGTTGAAAATG
GACAGGGAAAAGTTGATTGTGCCCAATCAAATTGGCTATCTGATACTAAA
GGAAGATGGAGCAGTTCTGGAGTCCGGCGGAGATCTGAAGAACGATGAGC
GCAGTGCAAATGTGATAATGGGATTACTAAATCTCACAGAGACCATCGAC
GAGTCCTTCATGCCGAGCAGCAGCTGCGAGAGGATCACCATCGATTACGA
GCATCACTACTACAGCATCTGCATGTCCAACCGTAGAATATACATCATTA
AGATCAGCAAATCGCAGAATGGCGTCACCACGACCACGAGCTCCTCCTCG
TCGAACAGCGTGTATAACGATGCCAGCGATTCCGGGGCAGTGCTGGCTTG
AAATCCGTCGTCGGATGTCCGACCCACTTGCAGATTCTGTTGGCAAGCAA
CCGGACAAAGACCCCACAATTGGCGCACTCCCATTATTTACCTAATCCTC
CTCTTTATTTGTCAAAAAATACATCATCTGTGAGCTCTTGCTCGAAAAAA
AAAAAAAAAAA

FI02884.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14977-RA 599 CG14977-RA 26..572 2..548 2735 100 Plus
CG14980-RB 1579 CG14980-RB 1496..1579 548..465 420 100 Minus
CG14980.a 1522 CG14980.a 1464..1522 548..490 295 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3896603..3896953 194..544 1725 99.4 Plus
chr3L 24539361 chr3L 3896354..3896546 2..193 915 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3897148..3897502 194..548 1775 100 Plus
3L 28110227 3L 3896900..3897091 2..193 960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3897148..3897502 194..548 1775 100 Plus
3L 28103327 3L 3896900..3897091 2..193 960 100 Plus
Blast to na_te.dros performed 2019-03-16 17:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 6982..7044 83..21 117 65.1 Minus

FI02884.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:53:38 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3896353..3896546 1..193 98 -> Plus
chr3L 3896603..3896953 194..544 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:51 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 1..363 39..401 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:56 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 1..363 39..401 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:40 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RB 1..495 39..533 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:02 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 1..363 39..401 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:11 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RB 1..495 39..533 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:20 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 1..543 2..544 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:56 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 1..543 2..544 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:40 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 1..543 2..544 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:23 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 2..544 2..544 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:11 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 1..543 2..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:38 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3896899..3897091 1..193 99 -> Plus
3L 3897148..3897498 194..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:38 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3896899..3897091 1..193 99 -> Plus
3L 3897148..3897498 194..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:53:38 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3896899..3897091 1..193 99 -> Plus
3L 3897148..3897498 194..544 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:40 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3896899..3897091 1..193 99 -> Plus
arm_3L 3897148..3897498 194..544 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:51 Download gff for FI02884.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3897148..3897498 194..544 100   Plus
3L 3896899..3897091 1..193 99 -> Plus

FI02884.pep Sequence

Translation from 38 to 400

> FI02884.pep
MLKMDREKLIVPNQIGYLILKEDGAVLESGGDLKNDERSANVIMGLLNLT
ETIDESFMPSSSCERITIDYEHHYYSICMSNRRIYIIKISKSQNGVTTTT
SSSSSNSVYNDASDSGAVLA*

FI02884.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24231-PA 117 GF24231-PA 1..117 4..120 514 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15167-PA 117 GG15167-PA 1..117 4..120 524 94.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15766-PA 134 GH15766-PA 1..119 4..119 432 75.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14977-PA 120 CG14977-PA 1..120 1..120 603 100 Plus
CG14977-PB 164 CG14977-PB 1..120 1..120 603 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12545-PA 120 GI12545-PA 1..120 4..120 435 75.4 Plus
Dmoj\GI14271-PA 120 GI14271-PA 1..120 4..120 435 75.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16055-PA 121 GL16055-PA 1..114 4..118 420 71.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13399-PA 121 GA13399-PA 1..114 4..118 420 71.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14596-PA 117 GM14596-PA 1..117 4..120 525 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17626-PA 117 GD17626-PA 1..117 4..120 591 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16063-PA 122 GJ16063-PA 1..107 4..113 412 74.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16740-PA 125 GK16740-PA 1..110 4..111 382 68.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21386-PA 117 GE21386-PA 1..117 4..120 528 94.9 Plus

FI02884.hyp Sequence

Translation from 38 to 400

> FI02884.hyp
MLKMDREKLIVPNQIGYLILKEDGAVLESGGDLKNDERSANVIMGLLNLT
ETIDESFMPSSSCERITIDYEHHYYSICMSNRRIYIIKISKSQNGVTTTT
SSSSSNSVYNDASDSGAVLA*

FI02884.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14977-PA 120 CG14977-PA 1..120 1..120 603 100 Plus
CG14977-PB 164 CG14977-PB 1..120 1..120 603 100 Plus