BDGP Sequence Production Resources |
Search the DGRC for FI02884
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 28 |
Well: | 84 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14977-RA |
Protein status: | FI02884.pep: gold |
Sequenced Size: | 561 |
Gene | Date | Evidence |
---|---|---|
CG14977 | 2008-08-15 | Release 5.9 accounting |
CG14977 | 2008-12-18 | 5.12 accounting |
561 bp assembled on 2008-07-25
GenBank Submission: BT032657
> FI02884.complete GACTGGTGGGTGTGGGTGCGAAAGATAAATAAATAAATATGTTGAAAATG GACAGGGAAAAGTTGATTGTGCCCAATCAAATTGGCTATCTGATACTAAA GGAAGATGGAGCAGTTCTGGAGTCCGGCGGAGATCTGAAGAACGATGAGC GCAGTGCAAATGTGATAATGGGATTACTAAATCTCACAGAGACCATCGAC GAGTCCTTCATGCCGAGCAGCAGCTGCGAGAGGATCACCATCGATTACGA GCATCACTACTACAGCATCTGCATGTCCAACCGTAGAATATACATCATTA AGATCAGCAAATCGCAGAATGGCGTCACCACGACCACGAGCTCCTCCTCG TCGAACAGCGTGTATAACGATGCCAGCGATTCCGGGGCAGTGCTGGCTTG AAATCCGTCGTCGGATGTCCGACCCACTTGCAGATTCTGTTGGCAAGCAA CCGGACAAAGACCCCACAATTGGCGCACTCCCATTATTTACCTAATCCTC CTCTTTATTTGTCAAAAAATACATCATCTGTGAGCTCTTGCTCGAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
accord2 | 7650 | accord2 QBERT 7650bp | 6982..7044 | 83..21 | 117 | 65.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 3896353..3896546 | 1..193 | 98 | -> | Plus |
chr3L | 3896603..3896953 | 194..544 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RA | 1..363 | 39..401 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RA | 1..363 | 39..401 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RB | 1..495 | 39..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RA | 1..363 | 39..401 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RB | 1..495 | 39..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RA | 1..543 | 2..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RA | 1..543 | 2..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RA | 1..543 | 2..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RA | 2..544 | 2..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14977-RA | 1..543 | 2..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3896899..3897091 | 1..193 | 99 | -> | Plus |
3L | 3897148..3897498 | 194..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3896899..3897091 | 1..193 | 99 | -> | Plus |
3L | 3897148..3897498 | 194..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3896899..3897091 | 1..193 | 99 | -> | Plus |
3L | 3897148..3897498 | 194..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 3896899..3897091 | 1..193 | 99 | -> | Plus |
arm_3L | 3897148..3897498 | 194..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3897148..3897498 | 194..544 | 100 | Plus | |
3L | 3896899..3897091 | 1..193 | 99 | -> | Plus |
Translation from 38 to 400
> FI02884.pep MLKMDREKLIVPNQIGYLILKEDGAVLESGGDLKNDERSANVIMGLLNLT ETIDESFMPSSSCERITIDYEHHYYSICMSNRRIYIIKISKSQNGVTTTT SSSSSNSVYNDASDSGAVLA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24231-PA | 117 | GF24231-PA | 1..117 | 4..120 | 514 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15167-PA | 117 | GG15167-PA | 1..117 | 4..120 | 524 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15766-PA | 134 | GH15766-PA | 1..119 | 4..119 | 432 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14977-PA | 120 | CG14977-PA | 1..120 | 1..120 | 603 | 100 | Plus |
CG14977-PB | 164 | CG14977-PB | 1..120 | 1..120 | 603 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12545-PA | 120 | GI12545-PA | 1..120 | 4..120 | 435 | 75.4 | Plus |
Dmoj\GI14271-PA | 120 | GI14271-PA | 1..120 | 4..120 | 435 | 75.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16055-PA | 121 | GL16055-PA | 1..114 | 4..118 | 420 | 71.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13399-PA | 121 | GA13399-PA | 1..114 | 4..118 | 420 | 71.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14596-PA | 117 | GM14596-PA | 1..117 | 4..120 | 525 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17626-PA | 117 | GD17626-PA | 1..117 | 4..120 | 591 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16063-PA | 122 | GJ16063-PA | 1..107 | 4..113 | 412 | 74.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16740-PA | 125 | GK16740-PA | 1..110 | 4..111 | 382 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21386-PA | 117 | GE21386-PA | 1..117 | 4..120 | 528 | 94.9 | Plus |
Translation from 38 to 400
> FI02884.hyp MLKMDREKLIVPNQIGYLILKEDGAVLESGGDLKNDERSANVIMGLLNLT ETIDESFMPSSSCERITIDYEHHYYSICMSNRRIYIIKISKSQNGVTTTT SSSSSNSVYNDASDSGAVLA*