Clone FI02892 Report

Search the DGRC for FI02892

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCG1665-RA
Protein status:FI02892.pep: gold
Sequenced Size:1203

Clone Sequence Records

FI02892.complete Sequence

1203 bp assembled on 2009-05-26

GenBank Submission: BT088431.1

> FI02892.complete
GAGTGGAGCTTTTGACTCAGAGAAAGCAACAAGTGTTACAGCGCAAAGGA
GATGGCAACCGGCGGAAATAACTCGACCTTTGACCTCAGTCCCAAGACCC
TGGCGGCCGTGGGCGTGGGCCTGGTGGCGGTGGGCGGGGCTAGCTTCCTA
CTGTACCGCCATCTGACCCGCGATGTGGTTCCCCAAAAGTGGCGACGCGT
GGGCACCGTGGAGAGGATACACTTTTTTCCGGTCAAGTCCTGTGCCCCTA
TGGACATCTCGAAGCCCGGAGTGGAGTACGACTGCGATGTACTGAGCATG
TCCTTTGAGGGAATAAGGGATCGCACCTTGATGGTGGTCAATGAAAAGAA
CGAAATGATCACGGCTCGGGTGTATCCGCTTATGACCCAGATCAAGTCGA
AGAAGGTGTCGCCCAGCAAGCTTGTGTTCAGCGCCCAGGACATGCCAGAC
CTGGAGCTGGACTTCGAGAAGCTGGACGGTCCTGGCAAGGATGTGAAAAC
TTCCGTTTGGGGCGTTTCCATAGACGTGATGCCCTGCGGAGATCGGATCA
ACACGTGGTTCTCCCAGGCCATCCTGAAGAAGGAGAGCGGCCTCAAGCTA
GTTCACTATCCCTATCCGAAACCAGTGAGATGCACCAATCCCCGCCTAAA
GTCCATGCCATTCATTAGACAGGAGGACTCGGGCACTTTTAACGATGCCA
CCAGCTTTATGCTGATGAACCTTTCGTCGGTCGCCGATCTTAATACTCGG
TTAAAGAATCCGGTGGATGCACTGCAGTTCCGAGGTAACTTCGAACTGAA
AATGGATGTTGATGAGCCCTATGCCGAGGACAATTGGCAGTGGGTGCGTA
TAGGCGAAGATGCTGTTTTCCGTACGGTGGCGCCATGCACTCGCTGTATT
TTTACCAACATTAATGCGAAGACCGCAGAGAGGAGTTCCGAAGGAGAGCC
TCTCAAAACGCTCAGAAGCTATCGCTTGTTCAACTACAGTTCGCCGGCTC
TGGGCGTTCATATGGGACTTCGGCTGCCGGGAAAGGTGAAGGCCAACGAC
GTCGTGTATGTGGAGGACAAGTGAATATTCCATTATCTCTTCTAACACTT
TATCCGGTATACATTGAAGTTTATTACATAGAACATAGATGAGAGTACTG
TAGAGTTTTATATGCAAATATACATGTGTTATGAGCCAAAAAAAAAAAAA
AAA

FI02892.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG1665-RA 1332 CG1665-RA 147..1332 2..1187 5930 100 Plus
CG1599.a 1206 CG1599.a 1111..1206 1187..1092 480 100 Minus
CG1599-RA 1107 CG1599-RA 1019..1107 1187..1099 445 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5727365..5727992 55..682 3125 99.8 Plus
chr2R 21145070 chr2R 5728059..5728346 681..968 1425 99.7 Plus
chr2R 21145070 chr2R 5728418..5728638 967..1187 1105 100 Plus
chr2R 21145070 chr2R 5727254..5727310 2..58 285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9839889..9840516 55..682 3125 99.8 Plus
2R 25286936 2R 9840583..9840870 681..968 1440 100 Plus
2R 25286936 2R 9840942..9841162 967..1187 1105 100 Plus
2R 25286936 2R 9839778..9839834 2..58 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9841088..9841715 55..682 3125 99.8 Plus
2R 25260384 2R 9841782..9842069 681..968 1440 100 Plus
2R 25260384 2R 9842141..9842361 967..1187 1105 100 Plus
2R 25260384 2R 9840977..9841033 2..58 285 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:53:54 has no hits.

FI02892.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:54:32 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5727253..5727310 1..58 98 -> Plus
chr2R 5727369..5727991 59..681 100 -> Plus
chr2R 5728060..5728346 682..968 99 -> Plus
chr2R 5728420..5728638 969..1187 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:38 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 1..1023 52..1074 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:29 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 1..1023 52..1074 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:05:44 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 1..1023 52..1074 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:17 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 1..1023 52..1074 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-26 10:38:49 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 1..1173 15..1187 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:29 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 1..1186 2..1187 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:05:44 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 2..1188 1..1187 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:17 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 2..1188 1..1187 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:32 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9839777..9839834 1..58 98 -> Plus
2R 9839893..9840515 59..681 100 -> Plus
2R 9840584..9840870 682..968 100 -> Plus
2R 9840944..9841162 969..1187 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:32 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9839777..9839834 1..58 98 -> Plus
2R 9839893..9840515 59..681 100 -> Plus
2R 9840584..9840870 682..968 100 -> Plus
2R 9840944..9841162 969..1187 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:32 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9839777..9839834 1..58 98 -> Plus
2R 9839893..9840515 59..681 100 -> Plus
2R 9840584..9840870 682..968 100 -> Plus
2R 9840944..9841162 969..1187 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:05:44 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5727282..5727339 1..58 98 -> Plus
arm_2R 5727398..5728020 59..681 100 -> Plus
arm_2R 5728089..5728375 682..968 100 -> Plus
arm_2R 5728449..5728667 969..1187 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:50 Download gff for FI02892.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9841092..9841714 59..681 100 -> Plus
2R 9841783..9842069 682..968 100 -> Plus
2R 9842143..9842361 969..1187 100   Plus
2R 9840976..9841033 1..58 98 -> Plus

FI02892.hyp Sequence

Translation from 51 to 1073

> FI02892.hyp
MATGGNNSTFDLSPKTLAAVGVGLVAVGGASFLLYRHLTRDVVPQKWRRV
GTVERIHFFPVKSCAPMDISKPGVEYDCDVLSMSFEGIRDRTLMVVNEKN
EMITARVYPLMTQIKSKKVSPSKLVFSAQDMPDLELDFEKLDGPGKDVKT
SVWGVSIDVMPCGDRINTWFSQAILKKESGLKLVHYPYPKPVRCTNPRLK
SMPFIRQEDSGTFNDATSFMLMNLSSVADLNTRLKNPVDALQFRGNFELK
MDVDEPYAEDNWQWVRIGEDAVFRTVAPCTRCIFTNINAKTAERSSEGEP
LKTLRSYRLFNYSSPALGVHMGLRLPGKVKANDVVYVEDK*

FI02892.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG1665-PA 340 CG1665-PA 1..340 1..340 1784 100 Plus

FI02892.pep Sequence

Translation from 51 to 1073

> FI02892.pep
MATGGNNSTFDLSPKTLAAVGVGLVAVGGASFLLYRHLTRDVVPQKWRRV
GTVERIHFFPVKSCAPMDISKPGVEYDCDVLSMSFEGIRDRTLMVVNEKN
EMITARVYPLMTQIKSKKVSPSKLVFSAQDMPDLELDFEKLDGPGKDVKT
SVWGVSIDVMPCGDRINTWFSQAILKKESGLKLVHYPYPKPVRCTNPRLK
SMPFIRQEDSGTFNDATSFMLMNLSSVADLNTRLKNPVDALQFRGNFELK
MDVDEPYAEDNWQWVRIGEDAVFRTVAPCTRCIFTNINAKTAERSSEGEP
LKTLRSYRLFNYSSPALGVHMGLRLPGKVKANDVVYVEDK*

FI02892.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13784-PA 340 GF13784-PA 1..339 1..339 1453 80.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24108-PA 340 GG24108-PA 1..340 1..340 1680 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20558-PA 337 GH20558-PA 6..337 7..340 1161 65.6 Plus
Dgri\GH20560-PA 338 GH20560-PA 7..338 7..340 1137 64.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Marc-PA 340 CG1665-PA 1..340 1..340 1784 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18828-PA 319 GI18828-PA 1..319 20..340 1244 69.5 Plus
Dmoj\GI18827-PA 319 GI18827-PA 1..319 20..340 1199 69.5 Plus
Dmoj\GI15478-PA 779 GI15478-PA 512..734 55..297 179 27.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20095-PA 343 GL20095-PA 2..339 4..340 1301 73.5 Plus
Dper\GL20094-PA 339 GL20094-PA 4..339 6..340 1194 65.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14085-PA 339 GA14085-PA 8..339 10..340 1290 74.5 Plus
Dpse\GA24930-PA 339 GA24930-PA 4..339 6..340 1211 66.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21156-PA 340 GM21156-PA 1..340 1..340 1801 98.5 Plus
Dsec\GM10090-PA 306 GM10090-PA 2..305 2..305 1607 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10688-PA 340 GD10688-PA 1..340 1..340 1811 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21855-PA 338 GJ21855-PA 12..338 12..340 1219 68.1 Plus
Dvir\GJ19190-PA 780 GJ19190-PA 497..737 42..297 157 25.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20639-PA 344 GK20639-PA 11..344 6..340 1249 66.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19306-PA 340 GE19306-PA 1..340 1..340 1663 94.1 Plus