Clone FI02937 Report

Search the DGRC for FI02937

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:29
Well:37
Vector:pFlc-1
Associated Gene/TranscriptCG14324-RA
Protein status:FI02937.pep: gold
Sequenced Size:475

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14324 2008-08-15 Release 5.9 accounting
CG14324 2008-12-18 5.12 accounting

Clone Sequence Records

FI02937.complete Sequence

475 bp assembled on 2008-07-25

GenBank Submission: BT032658

> FI02937.complete
AGATCCAATAGAGAACATGAGGCAAAACAAGATAACGATTTTGGGTCTGT
CCCTGCTGCTTTGTTTGGCGCTTGCACACTCACATGGTTTTGGTGGAAAG
CTTGGAGGAGGCTACGCCCCTGTCTACAACAACTTTGTCCCATATCCAGT
TGCCCAACCGATCCCAGTGGCCCAACCTGTTCCAGTTCCCGTGGCTATTC
CTCAACCAATTCCAGTCCCAGTCCCCCAACCAGTAGTTATTCCCATCAAA
CACGGATGGAAGGGTGGTCTAGGTCTAGGTGGATTTGGCGGAGGTTATGG
CGGCGGTTTCGGAGGCTACCAGAACTTTGCCTCTGCCTCCTCTTTTAGCT
CTGCCAGTTCATTTGGCGGTGGCTATGGCGGATTGGGTGGTGGCACCTTT
AGGCGGCGCTGAGAGTATTGTTCTATGTTTACTAAATATATATTTTAGAT
TGTTACAACAAAAAAAAAAAAAAAA

FI02937.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-RA 501 CG14324-RA 39..500 1..462 2295 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13442630..13443057 457..30 2125 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17618275..17618707 462..30 2150 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17359106..17359538 462..30 2150 99.7 Minus
3R 31820162 3R 17359592..17359622 31..1 155 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:44:45 has no hits.

FI02937.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:45:25 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13442628..13443055 32..459 99 <- Minus
chr3R 13443111..13443141 1..31 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:42:11 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 1..396 17..412 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:50 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 1..396 17..412 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:05:04 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 1..396 17..412 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:43:58 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 1..396 17..412 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:12 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 1..396 17..412 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:12 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 1..458 1..458 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:50 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 1..458 1..458 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:05:04 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 9..464 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:45:51 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 1..458 1..458 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:12 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 9..464 1..456 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:25 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17618278..17618705 32..459 99 <- Minus
3R 17618761..17618791 1..31 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:25 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17618278..17618705 32..459 99 <- Minus
3R 17618761..17618791 1..31 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:25 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17618278..17618705 32..459 99 <- Minus
3R 17618761..17618791 1..31 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:05:04 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13444000..13444427 32..459 99 <- Minus
arm_3R 13444483..13444513 1..31 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:43 Download gff for FI02937.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17359109..17359536 32..459 99 <- Minus
3R 17359592..17359622 1..31 100   Minus

FI02937.pep Sequence

Translation from 1 to 411

> FI02937.pep
DPIENMRQNKITILGLSLLLCLALAHSHGFGGKLGGGYAPVYNNFVPYPV
AQPIPVAQPVPVPVAIPQPIPVPVPQPVVIPIKHGWKGGLGLGGFGGGYG
GGFGGYQNFASASSFSSASSFGGGYGGLGGGTFRRR*

FI02937.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17179-PA 119 GF17179-PA 1..46 6..54 139 79.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-PA 131 CG14324-PA 1..131 6..136 710 100 Plus
CG5070-PA 209 CG5070-PA 90..190 29..130 152 35 Plus
CG10853-PA 155 CG10853-PA 27..92 58..135 137 45.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15353-PA 131 GM15353-PA 1..131 6..136 620 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20222-PA 131 GD20222-PA 1..131 6..136 624 97.7 Plus

FI02937.hyp Sequence

Translation from 1 to 411

> FI02937.hyp
DPIENMRQNKITILGLSLLLCLALAHSHGFGGKLGGGYAPVYNNFVPYPV
AQPIPVAQPVPVPVAIPQPIPVPVPQPVVIPIKHGWKGGLGLGGFGGGYG
GGFGGYQNFASASSFSSASSFGGGYGGLGGGTFRRR*

FI02937.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-PA 131 CG14324-PA 1..131 6..136 710 100 Plus
CG5070-PA 209 CG5070-PA 90..190 29..130 152 35 Plus
CG10853-PA 155 CG10853-PA 27..92 58..135 137 45.6 Plus