FI02937.complete Sequence
475 bp assembled on 2008-07-25
GenBank Submission: BT032658
> FI02937.complete
AGATCCAATAGAGAACATGAGGCAAAACAAGATAACGATTTTGGGTCTGT
CCCTGCTGCTTTGTTTGGCGCTTGCACACTCACATGGTTTTGGTGGAAAG
CTTGGAGGAGGCTACGCCCCTGTCTACAACAACTTTGTCCCATATCCAGT
TGCCCAACCGATCCCAGTGGCCCAACCTGTTCCAGTTCCCGTGGCTATTC
CTCAACCAATTCCAGTCCCAGTCCCCCAACCAGTAGTTATTCCCATCAAA
CACGGATGGAAGGGTGGTCTAGGTCTAGGTGGATTTGGCGGAGGTTATGG
CGGCGGTTTCGGAGGCTACCAGAACTTTGCCTCTGCCTCCTCTTTTAGCT
CTGCCAGTTCATTTGGCGGTGGCTATGGCGGATTGGGTGGTGGCACCTTT
AGGCGGCGCTGAGAGTATTGTTCTATGTTTACTAAATATATATTTTAGAT
TGTTACAACAAAAAAAAAAAAAAAA
FI02937.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:02:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14324-RA | 501 | CG14324-RA | 39..500 | 1..462 | 2295 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:44:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 13442630..13443057 | 457..30 | 2125 | 99.8 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:44:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17618275..17618707 | 462..30 | 2150 | 99.8 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 17359106..17359538 | 462..30 | 2150 | 99.7 | Minus |
3R | 31820162 | 3R | 17359592..17359622 | 31..1 | 155 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 09:44:45 has no hits.
FI02937.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:45:25 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 13442628..13443055 | 32..459 | 99 | <- | Minus |
chr3R | 13443111..13443141 | 1..31 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:42:11 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 1..396 | 17..412 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:50 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 1..396 | 17..412 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:05:04 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 1..396 | 17..412 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:43:58 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 1..396 | 17..412 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:12 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 1..396 | 17..412 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:12 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 1..458 | 1..458 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:50 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 1..458 | 1..458 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:05:04 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 9..464 | 1..456 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:45:51 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 1..458 | 1..458 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:12 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14324-RA | 9..464 | 1..456 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:25 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17618278..17618705 | 32..459 | 99 | <- | Minus |
3R | 17618761..17618791 | 1..31 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:25 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17618278..17618705 | 32..459 | 99 | <- | Minus |
3R | 17618761..17618791 | 1..31 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:25 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17618278..17618705 | 32..459 | 99 | <- | Minus |
3R | 17618761..17618791 | 1..31 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:05:04 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13444000..13444427 | 32..459 | 99 | <- | Minus |
arm_3R | 13444483..13444513 | 1..31 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:43 Download gff for
FI02937.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17359109..17359536 | 32..459 | 99 | <- | Minus |
3R | 17359592..17359622 | 1..31 | 100 | | Minus |
FI02937.pep Sequence
Translation from 1 to 411
> FI02937.pep
DPIENMRQNKITILGLSLLLCLALAHSHGFGGKLGGGYAPVYNNFVPYPV
AQPIPVAQPVPVPVAIPQPIPVPVPQPVVIPIKHGWKGGLGLGGFGGGYG
GGFGGYQNFASASSFSSASSFGGGYGGLGGGTFRRR*
FI02937.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:57:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17179-PA | 119 | GF17179-PA | 1..46 | 6..54 | 139 | 79.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14324-PA | 131 | CG14324-PA | 1..131 | 6..136 | 710 | 100 | Plus |
CG5070-PA | 209 | CG5070-PA | 90..190 | 29..130 | 152 | 35 | Plus |
CG10853-PA | 155 | CG10853-PA | 27..92 | 58..135 | 137 | 45.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:57:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15353-PA | 131 | GM15353-PA | 1..131 | 6..136 | 620 | 96.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:57:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20222-PA | 131 | GD20222-PA | 1..131 | 6..136 | 624 | 97.7 | Plus |
FI02937.hyp Sequence
Translation from 1 to 411
> FI02937.hyp
DPIENMRQNKITILGLSLLLCLALAHSHGFGGKLGGGYAPVYNNFVPYPV
AQPIPVAQPVPVPVAIPQPIPVPVPQPVVIPIKHGWKGGLGLGGFGGGYG
GGFGGYQNFASASSFSSASSFGGGYGGLGGGTFRRR*
FI02937.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:25:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14324-PA | 131 | CG14324-PA | 1..131 | 6..136 | 710 | 100 | Plus |
CG5070-PA | 209 | CG5070-PA | 90..190 | 29..130 | 152 | 35 | Plus |
CG10853-PA | 155 | CG10853-PA | 27..92 | 58..135 | 137 | 45.6 | Plus |