Clone FI02974 Report

Search the DGRC for FI02974

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:29
Well:74
Vector:pFlc-1
Associated Gene/TranscriptJTBR-RA
Protein status:FI02974.pep: gold
Sequenced Size:845

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
JTBR 2008-08-15 Release 5.9 accounting
JTBR 2008-12-18 5.12 accounting

Clone Sequence Records

FI02974.complete Sequence

845 bp assembled on 2008-07-28

GenBank Submission: BT032659

> FI02974.complete
GATAGGGGGAAAAGCAAAGCAATAGGATTTCGAGTAATCCCGTCCATATG
TATTGGAGTTATCCACCTACTGAGCATGCATAGGTTCTTCCAGGTTGTTT
CCAGCACTTGATCCGATACAAGAGTTAGCTGCCCGCCTTCACAATGCTCG
AGAACTGTCAGCGTCACCACATGCTCCTTGGACTAGGAGCCCTAACGATG
GTCACCATACTCGTCCTGTTCGTGGAATCTCGTTACGCGGCAGATGGTCC
TCGTCGCCGAGAGCCGCAATTCGTGATCGAGGACAACTCGACCTGCTGGC
GGAATGAGAAGTACACGATGGTGCAGGAGTGCCACCCGTGCTCCGAATTC
GATATAGTCAGCCGGAGCTTGGGCGTCTGCATTCACACGCACTACAAGGA
GGTGCTGCGCTGCCAGAGCGGCGAGATCGTAACCAGGAGCTGCGACCGGG
TGGCGCTCATCGAGCAAATGAACTTCTTGAAATTTGAGGTCTCGTGCTTT
GTAATCGGATTACTTAGCTACCTGGTCAGTTATGCCCGCGATCGAGTCCT
GTCCAGGCGCAACTACATGAGAATCGAGCGACAGCTAAACCGGGTCCAAT
AGCCCTCCGCCAAATCATCGATTCCCTTCCCCAAGTGATACTCATTGACC
GTACGGAAGGTACATTATTTAATTTAGTTTAAGTACATACACTCTGGAAA
TACCATGTTAAAATTCATTTGCTAATACTAGGGGGTTTAATATATTGCAT
ACTTGTGGAATGCTTGTTTTCAGGGGACAAACACAATTCGGCGTTAATAA
TATGCATAACATTTTGCTTCGGTAATAACAAAAAAAAAAAAAAAA

FI02974.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
JTBR-RA 828 JTBR-RA 1..828 2..829 4140 100 Plus
JTBR.a 817 JTBR.a 70..817 84..831 3740 100 Plus
JTBR.b 868 JTBR.b 83..820 94..831 3690 100 Plus
JTBR.a 817 JTBR.a 38..71 2..35 170 100 Plus
JTBR.b 868 JTBR.b 51..84 2..35 170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1801568..1802395 829..2 4140 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1802006..1802835 831..2 4150 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1802006..1802835 831..2 4150 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:13:12 has no hits.

FI02974.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:13:52 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1801568..1802395 1..829 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:42:17 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 1..459 144..602 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:15 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 1..459 144..602 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:32:40 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 1..459 144..602 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:47 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 1..459 144..602 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:24:08 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 1..459 144..602 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:47 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 1..828 2..829 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:15 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 1..828 2..829 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:32:40 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 21..849 1..829 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:21:43 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 1..828 2..829 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:24:08 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
JTBR-RA 21..849 1..829 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:52 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1802008..1802835 1..829 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:52 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1802008..1802835 1..829 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:52 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1802008..1802835 1..829 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:32:40 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1802008..1802835 1..829 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:16 Download gff for FI02974.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1802008..1802835 1..829 99   Minus

FI02974.hyp Sequence

Translation from 143 to 601

> FI02974.hyp
MLENCQRHHMLLGLGALTMVTILVLFVESRYAADGPRRREPQFVIEDNST
CWRNEKYTMVQECHPCSEFDIVSRSLGVCIHTHYKEVLRCQSGEIVTRSC
DRVALIEQMNFLKFEVSCFVIGLLSYLVSYARDRVLSRRNYMRIERQLNR
VQ*

FI02974.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
JTBR-PC 152 CG1935-PC 1..152 1..152 799 100 Plus
JTBR-PB 152 CG1935-PB 1..152 1..152 799 100 Plus
JTBR-PA 152 CG1935-PA 1..152 1..152 799 100 Plus

FI02974.pep Sequence

Translation from 143 to 601

> FI02974.pep
MLENCQRHHMLLGLGALTMVTILVLFVESRYAADGPRRREPQFVIEDNST
CWRNEKYTMVQECHPCSEFDIVSRSLGVCIHTHYKEVLRCQSGEIVTRSC
DRVALIEQMNFLKFEVSCFVIGLLSYLVSYARDRVLSRRNYMRIERQLNR
VQ*

FI02974.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24960-PA 152 GF24960-PA 1..152 1..152 718 86.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14558-PA 152 GG14558-PA 1..152 1..152 782 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15043-PA 154 GH15043-PA 1..154 1..152 581 78.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
JTBR-PC 152 CG1935-PC 1..152 1..152 799 100 Plus
JTBR-PB 152 CG1935-PB 1..152 1..152 799 100 Plus
JTBR-PA 152 CG1935-PA 1..152 1..152 799 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12800-PA 154 GI12800-PA 1..154 1..152 674 81.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24826-PA 152 GL24826-PA 1..152 1..152 697 83.6 Plus
Dper\GL15613-PA 152 GL15613-PA 1..152 1..152 697 83.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15138-PA 152 GA15138-PA 1..152 1..152 697 83.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14167-PA 152 GM14167-PA 1..152 1..152 805 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13436-PA 152 GD13436-PA 1..152 1..152 805 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12948-PA 154 GJ12948-PA 1..154 1..152 686 83.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20566-PA 145 GK20566-PA 1..138 1..137 550 81.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20912-PA 152 GE20912-PA 1..152 1..152 776 95.4 Plus