BDGP Sequence Production Resources |
Search the DGRC for FI02974
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 29 |
Well: | 74 |
Vector: | pFlc-1 |
Associated Gene/Transcript | JTBR-RA |
Protein status: | FI02974.pep: gold |
Sequenced Size: | 845 |
Gene | Date | Evidence |
---|---|---|
JTBR | 2008-08-15 | Release 5.9 accounting |
JTBR | 2008-12-18 | 5.12 accounting |
845 bp assembled on 2008-07-28
GenBank Submission: BT032659
> FI02974.complete GATAGGGGGAAAAGCAAAGCAATAGGATTTCGAGTAATCCCGTCCATATG TATTGGAGTTATCCACCTACTGAGCATGCATAGGTTCTTCCAGGTTGTTT CCAGCACTTGATCCGATACAAGAGTTAGCTGCCCGCCTTCACAATGCTCG AGAACTGTCAGCGTCACCACATGCTCCTTGGACTAGGAGCCCTAACGATG GTCACCATACTCGTCCTGTTCGTGGAATCTCGTTACGCGGCAGATGGTCC TCGTCGCCGAGAGCCGCAATTCGTGATCGAGGACAACTCGACCTGCTGGC GGAATGAGAAGTACACGATGGTGCAGGAGTGCCACCCGTGCTCCGAATTC GATATAGTCAGCCGGAGCTTGGGCGTCTGCATTCACACGCACTACAAGGA GGTGCTGCGCTGCCAGAGCGGCGAGATCGTAACCAGGAGCTGCGACCGGG TGGCGCTCATCGAGCAAATGAACTTCTTGAAATTTGAGGTCTCGTGCTTT GTAATCGGATTACTTAGCTACCTGGTCAGTTATGCCCGCGATCGAGTCCT GTCCAGGCGCAACTACATGAGAATCGAGCGACAGCTAAACCGGGTCCAAT AGCCCTCCGCCAAATCATCGATTCCCTTCCCCAAGTGATACTCATTGACC GTACGGAAGGTACATTATTTAATTTAGTTTAAGTACATACACTCTGGAAA TACCATGTTAAAATTCATTTGCTAATACTAGGGGGTTTAATATATTGCAT ACTTGTGGAATGCTTGTTTTCAGGGGACAAACACAATTCGGCGTTAATAA TATGCATAACATTTTGCTTCGGTAATAACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
JTBR-RA | 828 | JTBR-RA | 1..828 | 2..829 | 4140 | 100 | Plus |
JTBR.a | 817 | JTBR.a | 70..817 | 84..831 | 3740 | 100 | Plus |
JTBR.b | 868 | JTBR.b | 83..820 | 94..831 | 3690 | 100 | Plus |
JTBR.a | 817 | JTBR.a | 38..71 | 2..35 | 170 | 100 | Plus |
JTBR.b | 868 | JTBR.b | 51..84 | 2..35 | 170 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 1801568..1802395 | 829..2 | 4140 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 1802006..1802835 | 831..2 | 4150 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 1802006..1802835 | 831..2 | 4150 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 1801568..1802395 | 1..829 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 1..459 | 144..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 1..459 | 144..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 1..459 | 144..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 1..459 | 144..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 1..459 | 144..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 1..828 | 2..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 1..828 | 2..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 21..849 | 1..829 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 1..828 | 2..829 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
JTBR-RA | 21..849 | 1..829 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1802008..1802835 | 1..829 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1802008..1802835 | 1..829 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1802008..1802835 | 1..829 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 1802008..1802835 | 1..829 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1802008..1802835 | 1..829 | 99 | Minus |
Translation from 143 to 601
> FI02974.hyp MLENCQRHHMLLGLGALTMVTILVLFVESRYAADGPRRREPQFVIEDNST CWRNEKYTMVQECHPCSEFDIVSRSLGVCIHTHYKEVLRCQSGEIVTRSC DRVALIEQMNFLKFEVSCFVIGLLSYLVSYARDRVLSRRNYMRIERQLNR VQ*
Translation from 143 to 601
> FI02974.pep MLENCQRHHMLLGLGALTMVTILVLFVESRYAADGPRRREPQFVIEDNST CWRNEKYTMVQECHPCSEFDIVSRSLGVCIHTHYKEVLRCQSGEIVTRSC DRVALIEQMNFLKFEVSCFVIGLLSYLVSYARDRVLSRRNYMRIERQLNR VQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24960-PA | 152 | GF24960-PA | 1..152 | 1..152 | 718 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14558-PA | 152 | GG14558-PA | 1..152 | 1..152 | 782 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15043-PA | 154 | GH15043-PA | 1..154 | 1..152 | 581 | 78.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
JTBR-PC | 152 | CG1935-PC | 1..152 | 1..152 | 799 | 100 | Plus |
JTBR-PB | 152 | CG1935-PB | 1..152 | 1..152 | 799 | 100 | Plus |
JTBR-PA | 152 | CG1935-PA | 1..152 | 1..152 | 799 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12800-PA | 154 | GI12800-PA | 1..154 | 1..152 | 674 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24826-PA | 152 | GL24826-PA | 1..152 | 1..152 | 697 | 83.6 | Plus |
Dper\GL15613-PA | 152 | GL15613-PA | 1..152 | 1..152 | 697 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15138-PA | 152 | GA15138-PA | 1..152 | 1..152 | 697 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14167-PA | 152 | GM14167-PA | 1..152 | 1..152 | 805 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13436-PA | 152 | GD13436-PA | 1..152 | 1..152 | 805 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12948-PA | 154 | GJ12948-PA | 1..154 | 1..152 | 686 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20566-PA | 145 | GK20566-PA | 1..138 | 1..137 | 550 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20912-PA | 152 | GE20912-PA | 1..152 | 1..152 | 776 | 95.4 | Plus |