Clone FI02976 Report

Search the DGRC for FI02976

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:29
Well:76
Vector:pFlc-1
Associated Gene/TranscriptCG13043-RA
Protein status:FI02976.pep: gold
Sequenced Size:659

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13043 2008-08-15 Release 5.9 accounting
CG13043 2008-12-18 5.12 accounting

Clone Sequence Records

FI02976.complete Sequence

659 bp assembled on 2008-07-29

GenBank Submission: BT032882.1

> FI02976.complete
GAACAGTTCTCGCAAGAAACTCAAACCGATCACTCCCAATTCCAAACAGT
CAATACAGACCTAACCCATTTCCAAAATGTTCAAGTTGGTGGTATTGTCT
GCTCTGCTCGCTGTAGCCGCTGCCCGTCCCGGTCACCTGTTGGAGTCCTC
CCCGCTGGTCTACGCTGCCCCAGCAGCGACGACCATCGTCCAGGAGCCCG
TTCTGGCCAAGGTGGGAGCCGTGGTCAAGAGCGTACCCACTGCCGTCAGC
CACCAGAGCCAGTCGGTGGTGCACAGTCACGCTCATGTTGTCGAGGATGT
CGTTGCTCCCGTGGTGAAGTCCACTCCGGTGGTCAGCTATGCTGCTGCCG
CTCCAGTGGTTCACACCTCCTATGCCGCTGCTCCCGTTGTCCACACCAGT
TACGCTGCTCCTGCTCCCGTTGTTCACACATCCTACGCCGCCGCCGCTCC
CGTTCTGGCCACATCCTACGCCCAAGTGGCCGCCTCCTCGCCGCTGACCT
ACACCGCCACTGGTGTGTGGTAAATCCATGGCCAGGCCCACTCCGAATCC
TACTCCTCTCACTGTTGACAGGTGACCAGGATGCATGTGCATCGCTGGAC
GGTTTTGTGATACGAATTTTAAATAAATAAATGTTTTGCTTTGAAAAAAA
AAAAAAAAA

FI02976.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13043-RA 645 CG13043-RA 1..645 2..646 3225 100 Plus
CG13063-RA 646 CG13063-RA 101..420 77..399 705 81.7 Plus
CG13042-RA 726 CG13042-RA 289..365 183..259 175 81.8 Plus
CG13042-RA 726 CG13042-RA 185..245 73..133 155 83.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16294952..16295593 643..2 3165 99.5 Minus
chr3L 24539361 chr3L 16296447..16296755 88..399 685 82.1 Plus
chr3L 24539361 chr3L 16292521..16292660 324..182 245 79.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16305222..16305866 646..2 3225 100 Minus
3L 28110227 3L 16306720..16307028 88..399 655 81.4 Plus
3L 28110227 3L 16302807..16302946 324..182 245 79.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16298322..16298966 646..2 3225 100 Minus
3L 28103327 3L 16299884..16300128 155..399 595 82.8 Plus
3L 28103327 3L 16295952..16296046 276..182 235 83.1 Minus
Blast to na_te.dros performed on 2019-03-16 15:37:08 has no hits.

FI02976.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:37:55 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16294952..16295593 1..643 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:42:21 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 1..447 77..523 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:34 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 1..447 77..523 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:50:23 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 1..447 77..523 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:51 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 1..447 77..523 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:50:53 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 1..447 77..523 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:47 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 1..642 2..643 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:34 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 1..642 2..643 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:50:23 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 3..646 1..643 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:20:42 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 1..642 2..643 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:50:53 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 3..646 1..643 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:37:55 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16305225..16305866 1..643 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:37:55 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16305225..16305866 1..643 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:37:55 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16305225..16305866 1..643 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:50:23 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16298325..16298966 1..643 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:53 Download gff for FI02976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16298325..16298966 1..643 99   Minus

FI02976.hyp Sequence

Translation from 3 to 629

> FI02976.hyp
QFSQETQTDHSQFQTVNTDLTHFQNVQVGGIVCSARCSRCPSRSPVGVLP
AGLRCPSSDDHRPGARSGQGGSRGQERTHCRQPPEPVGGAQSRSCCRGCR
CSRGEVHSGGQLCCCRSSGSHLLCRCSRCPHQLRCSCSRCSHILRRRRSR
SGHILRPSGRLLAADLHRHWCVVNPWPGPLRILLLSLLTGDQDACASLDG
FVIRILNK*
Sequence FI02976.hyp has no blast hits.

FI02976.pep Sequence

Translation from 76 to 522

> FI02976.pep
MFKLVVLSALLAVAAARPGHLLESSPLVYAAPAATTIVQEPVLAKVGAVV
KSVPTAVSHQSQSVVHSHAHVVEDVVAPVVKSTPVVSYAAAAPVVHTSYA
AAPVVHTSYAAPAPVVHTSYAAAAPVLATSYAQVAASSPLTYTATGVW*

FI02976.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10298-PA 145 GF10298-PA 1..145 1..148 481 83.8 Plus
Dana\GF24178-PA 138 GF24178-PA 1..127 1..129 410 79.5 Plus
Dana\GF10297-PA 112 GF10297-PA 1..106 1..117 243 52.1 Plus
Dana\GF10299-PA 158 GF10299-PA 1..65 1..67 223 77.6 Plus
Dana\GF24187-PA 194 GF24187-PA 110..173 26..86 150 54.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13470-PA 147 GG13470-PA 1..147 1..148 663 98.6 Plus
Dere\GG15982-PA 129 GG15982-PA 1..127 1..130 396 85.4 Plus
Dere\GG13469-PA 117 GG13469-PA 1..110 1..111 246 53.9 Plus
Dere\GG13471-PA 155 GG13471-PA 1..155 1..148 231 56 Plus
Dere\GG15991-PA 191 GG15991-PA 107..172 26..88 151 53 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15608-PA 163 GH15608-PA 1..163 1..148 474 76.4 Plus
Dgri\GH15607-PA 111 GH15607-PA 1..102 1..113 211 61.7 Plus
Dgri\GH15610-PA 166 GH15610-PA 1..145 1..144 210 59.1 Plus
Dgri\GH15877-PA 123 GH15877-PA 1..116 1..112 163 45.4 Plus
Dgri\GH15606-PA 114 GH15606-PA 1..107 1..112 160 48.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13043-PA 148 CG13043-PA 1..148 1..148 725 100 Plus
CG13063-PA 129 CG13063-PA 1..127 1..130 530 85.4 Plus
CG13044-PA 155 CG13044-PA 1..155 1..148 374 60.8 Plus
CG13042-PA 117 CG13042-PA 1..102 1..103 270 57.9 Plus
CG13060-PA 131 CG13060-PA 1..128 1..143 212 48.3 Plus
CG13041-PA 124 CG13041-PA 1..121 1..143 203 47.3 Plus
CG13059-PA 155 CG13059-PA 1..142 1..143 164 38.4 Plus
CG34205-PA 217 CG34205-PA 24..210 3..137 163 35.4 Plus
CG13040-PB 185 CG13040-PB 1..116 1..129 159 38.5 Plus
CG13040-PA 185 CG13040-PA 1..116 1..129 159 38.5 Plus
retinin-PA 191 CG13057-PA 107..170 26..86 159 51.6 Plus
CG18294-PA 141 CG18294-PA 1..133 1..144 138 37.2 Plus
CG45069-PB 129 CG45069-PB 38..106 77..146 137 47.9 Plus
CG45069-PA 129 CG45069-PA 38..106 77..146 137 47.9 Plus
CG13674-PB 137 CG13674-PB 3..133 2..140 137 37 Plus
CG13674-PA 137 CG13674-PA 3..133 2..140 137 37 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16885-PA 140 GI16885-PA 1..140 1..148 444 81.8 Plus
Dmoj\GI16886-PA 146 GI16886-PA 1..132 1..144 190 55.1 Plus
Dmoj\GI16883-PA 112 GI16883-PA 1..106 1..117 181 56.3 Plus
Dmoj\GI16532-PA 183 GI16532-PA 99..164 26..88 144 47 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18010-PA 142 GL18010-PA 1..142 1..148 417 81.2 Plus
Dper\GL17864-PA 120 GL17864-PA 1..111 1..122 343 77 Plus
Dper\GL17848-PA 120 GL17848-PA 1..111 1..122 343 77.9 Plus
Dper\GL17989-PA 120 GL17989-PA 1..111 1..122 336 76.2 Plus
Dper\GL18447-PA 134 GL18447-PA 1..70 1..70 238 88.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11997-PA 142 GA11997-PA 1..142 1..148 416 81.2 Plus
Dpse\GA28359-PA 120 GA28359-PA 1..111 1..122 343 77 Plus
Dpse\GA28511-PA 120 GA28511-PA 1..111 1..122 340 77 Plus
Dpse\GA28521-PA 120 GA28521-PA 1..111 1..122 324 74.6 Plus
Dpse\GA11996-PA 110 GA11996-PA 1..100 1..113 226 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24419-PA 148 GM24419-PA 1..148 1..148 676 99.3 Plus
Dsec\GM25614-PA 129 GM25614-PA 1..127 1..130 397 85.4 Plus
Dsec\GM24418-PA 117 GM24418-PA 1..110 1..111 250 54.8 Plus
Dsec\GM24420-PA 155 GM24420-PA 1..155 1..148 231 56 Plus
Dsec\GM25623-PA 191 GM25623-PA 107..170 26..86 150 54.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12489-PA 148 GD12489-PA 1..148 1..148 668 98 Plus
Dsim\GD14619-PA 129 GD14619-PA 1..127 1..130 398 85.4 Plus
Dsim\GD12488-PA 117 GD12488-PA 1..110 1..111 250 54.8 Plus
Dsim\GD12490-PA 155 GD12490-PA 1..155 1..148 231 56 Plus
Dsim\GD14627-PA 175 GD14627-PA 91..156 26..88 150 53 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12633-PA 170 GJ12633-PA 1..170 1..148 486 73.1 Plus
Dvir\GJ12632-PA 113 GJ12632-PA 1..107 1..117 213 57.3 Plus
Dvir\GJ12634-PA 152 GJ12634-PA 1..64 1..67 174 76.1 Plus
Dvir\GJ12785-PA 179 GJ12785-PA 95..174 26..105 154 48.2 Plus
Dvir\GJ12779-PA 115 GJ12779-PA 1..112 1..143 138 42.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17642-PA 147 GK17642-PA 1..147 1..148 435 82.9 Plus
Dwil\GK16556-PA 131 GK16556-PA 1..120 1..129 310 80 Plus
Dwil\GK17641-PA 115 GK17641-PA 1..104 1..113 232 50.4 Plus
Dwil\GK17643-PA 148 GK17643-PA 1..135 1..127 181 55.4 Plus
Dwil\GK16560-PA 128 GK16560-PA 1..73 1..85 139 47.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22900-PA 148 GE22900-PA 1..148 1..148 683 100 Plus
Dyak\GE22803-PA 137 GE22803-PA 1..137 1..148 498 92.6 Plus
Dyak\GE23097-PA 129 GE23097-PA 1..127 1..130 484 84.6 Plus
Dyak\GE23177-PA 129 GE23177-PA 1..127 1..130 398 85.4 Plus
Dyak\GE22801-PA 117 GE22801-PA 1..110 1..111 246 53.9 Plus