Clone FI03234 Report

Search the DGRC for FI03234

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:34
Vector:pFlc-1
Associated Gene/TranscriptCG8152-RA
Protein status:FI03234.pep: gold
Sequenced Size:1217

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8152 2008-08-15 Release 5.9 accounting
CG8152 2008-12-18 5.12 accounting

Clone Sequence Records

FI03234.complete Sequence

1217 bp assembled on 2008-08-06

GenBank Submission: BT044136.1

> FI03234.complete
GTTTTTGAGCACTACGCAGCTCTGACGCACATCTGCGAAATGTTTATTTA
CAAAACGAGTTAGCATCATTATTGTCAAAAATGAATTCTCAAAACGAATT
GCATCCAAATTGGCTGGCTCTAACAACATTGCCACTCCAACTGAAGCGAT
TCGTCCGAGCAGGAGATCCGGATTTTATCGCCGAGTCCCCGAAAGCAGTA
AAGCACCAAATCGATGGCTTAAACGGAGCAGAAGCTCGTGAGTTCTACAA
GGAGGTGTTGGATGCGCCCACAACCTGCCAACCTAACCTTCCAAGTACCC
ACAAAACTGCACAAACAAGAAGAGAGCCAGAAAGGATCCTAGTCCCCTTC
GACAAAAGCAAATTTTTCCGTTTGGCCACTAGCAACAAAGTAGAGGAGCT
GTCTCAAATGAAGGCCTCAGAAGAGGATTTAAATTCTCGGGATTCCTTTG
GCTGGACTGCCTTGATGATGGCTGCCTGTGAAGGAGCCACGGAGGCAGTG
AGTTGGCTCGTGCAGAGAGGGGTCCAAGTAGAGACCTCAGACAAATCCGG
AAACACAGCTCTGAAACTGGCCCAACGAAAAGGTCACTTAGATGTAGTTC
ATCTTTTGGAATCCCTACCCATTTTAGAGGAAACTAGCGAAGAGGATGAG
TCAGTTGATGGCAACAACCCCTTTTACTGTGAAATCTGTAAGAGGGACTA
CAAAGAAACCCCCTGGCCAATTCATCAAACATCCACAGTGCATCAGTTCA
ATCTAAAGGCTCTGCCCGCTCATAAGCTCCACAAATTTAACATATCTGCC
AAAAATCGAGGACTCCAGCTGATGGTGAAACAGGGCTGGGACCAGGAGCA
CGGATTGGGACCGAGTCAAAGTGGGCGATTGTATCCCGTCAAGACTGTTC
TTCGAAAGCAACGCACTGGACTGGGAATTGAACAGCAGTCGGCAAGGGTC
TCCCACTTTGGTGCCTTCGATTTAAACGCTGTTAGGAGAAGGGATCCCAT
ATATCAGCCGAGAAGGACGCGAAGCGATATGCAGAGGGAAAAGGTGCGCG
AATGGAAGCGAGAACGGTACCTCCGCAGGGTACTAAGTTAAAGATGGCTT
ACAGAGAAAGCTAACAAGAATTGTACTATAAATTATAAATGGAGCCAGCC
TAAGATGTTTTTTAAGAGCAAAATAATAAATTTAATTATTAATAATGGGG
AAAAAAAAAAAAAAAAA

FI03234.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8152-RA 1199 CG8152-RA 1..1197 2..1198 5985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11197133..11198326 1195..2 5865 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15309933..15311129 1198..2 5985 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15311132..15312328 1198..2 5985 100 Minus
Blast to na_te.dros performed 2019-03-16 06:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 241..323 1112..1195 111 60.7 Plus
G4 3856 G4 G4_DM 3856bp 13..66 700..754 110 69.1 Plus

FI03234.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:17:01 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11197161..11198326 1..1167 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:43:02 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 1..1011 81..1091 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:39:38 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 1..1011 81..1091 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:57:09 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 1..1011 81..1091 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:17:54 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 1..1011 81..1091 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:05 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 1..1011 81..1091 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:09:17 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 1..1199 2..1200 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:39:38 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 1..1199 2..1200 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:09 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 5..1204 1..1200 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-06 16:09:12 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 1..1199 2..1200 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:05 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
CG8152-RA 5..1204 1..1200 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:01 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15309931..15311129 1..1200 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:01 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15309931..15311129 1..1200 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:01 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15309931..15311129 1..1200 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:09 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11197436..11198634 1..1200 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:49 Download gff for FI03234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15311130..15312328 1..1200 99   Minus

FI03234.hyp Sequence

Translation from 80 to 1090

> FI03234.hyp
MNSQNELHPNWLALTTLPLQLKRFVRAGDPDFIAESPKAVKHQIDGLNGA
EAREFYKEVLDAPTTCQPNLPSTHKTAQTRREPERILVPFDKSKFFRLAT
SNKVEELSQMKASEEDLNSRDSFGWTALMMAACEGATEAVSWLVQRGVQV
ETSDKSGNTALKLAQRKGHLDVVHLLESLPILEETSEEDESVDGNNPFYC
EICKRDYKETPWPIHQTSTVHQFNLKALPAHKLHKFNISAKNRGLQLMVK
QGWDQEHGLGPSQSGRLYPVKTVLRKQRTGLGIEQQSARVSHFGAFDLNA
VRRRDPIYQPRRTRSDMQREKVREWKRERYLRRVLS*

FI03234.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8152-PA 336 CG8152-PA 1..336 1..336 1763 100 Plus

FI03234.pep Sequence

Translation from 80 to 1090

> FI03234.pep
MNSQNELHPNWLALTTLPLQLKRFVRAGDPDFIAESPKAVKHQIDGLNGA
EAREFYKEVLDAPTTCQPNLPSTHKTAQTRREPERILVPFDKSKFFRLAT
SNKVEELSQMKASEEDLNSRDSFGWTALMMAACEGATEAVSWLVQRGVQV
ETSDKSGNTALKLAQRKGHLDVVHLLESLPILEETSEEDESVDGNNPFYC
EICKRDYKETPWPIHQTSTVHQFNLKALPAHKLHKFNISAKNRGLQLMVK
QGWDQEHGLGPSQSGRLYPVKTVLRKQRTGLGIEQQSARVSHFGAFDLNA
VRRRDPIYQPRRTRSDMQREKVREWKRERYLRRVLS*

FI03234.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11874-PA 335 GF11874-PA 1..335 1..336 1249 71.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22360-PA 453 GG22360-PA 140..453 23..336 1512 89.2 Plus
Dere\GG22360-PA 453 GG22360-PA 1..139 1..139 632 86.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21459-PA 338 GH21459-PA 1..338 1..336 1017 59.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8152-PA 336 CG8152-PA 1..336 1..336 1763 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19937-PA 341 GI19937-PA 1..327 1..322 953 57.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11013-PA 155 GL11013-PA 1..155 1..154 434 56.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20853-PA 338 GA20853-PA 1..338 1..336 1130 64.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20145-PA 336 GM20145-PA 1..336 1..336 1720 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25624-PA 336 GD25624-PA 1..336 1..336 1717 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15105-PA 345 GJ15105-PA 3..345 2..336 1052 60.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20753-PA 339 GK20753-PA 1..339 1..336 978 60.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12248-PA 335 GE12248-PA 1..335 1..336 1617 89.3 Plus