Clone FI03378 Report

Search the DGRC for FI03378

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:33
Well:78
Vector:pFlc-1
Associated Gene/TranscriptOsi3-RA
Protein status:FI03378.pep: gold
Sequenced Size:1146

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Osi3 2008-08-15 Release 5.9 accounting
Osi3 2008-12-18 5.12 accounting

Clone Sequence Records

FI03378.complete Sequence

1146 bp assembled on 2008-07-17

GenBank Submission: BT044145.1

> FI03378.complete
AGTAGGTTTTCTATCAAGACGACGATGTCAACAGCAAGACCGTAGCACTT
CTAGTAGAGCGAAGACGCGGGCGACTGTGAGAGTGTGATTGTGTGTGATC
AGAGCCAGAGGATACGGCCAGGATATACGTGTGCTAGTGTGTGTATCAGT
CAATCCAAGTGTAACCCAAGAAAAACTGAGCGCAACAACTGAGAACGCTT
AAATAGCCCGAAATCAACGAGACCAACGATGCAAACATTTAAGGTCTGCG
CTCTCCTGGCGTTCTGCTTCGTCCTCGTTTCCGCCCGCGGCAGCAAACGG
CGCGATGGCACCGTTACGATATCGGAGAGCGAACGAAAGAACATTGAGGA
CTTTCTGTTGGCCAAGCTTAAGCAAAATTGCAGGCAGGAAGACGATCGCG
CCTGTAAGATGGTCAAGATGTCTATTGTGATGAACCATCTGTACCTGAAC
ACCCGTATCGACCTTGGCGACCGATTCAAGGTCACAGAAAACGGGAATAT
CTCAATGGTACCAGATGATCCGGAGGTCAACCAGCTGCTGTCACGCTCTA
TGGGGTCCGATGAGGAGACCTTCGCCCTTCTGATGGCCAACAAGCTGTGG
AAATTCATTCGTTCGCGCTCCCTGCGATACAAGTTCTCAGAGAACACGGA
CTTTGTGATCAACAGCGATCCGGAGGGCAGTCTGAATTTGGGCGTATCAG
TGCGCCCCCTGGAGGCGTTGCAGGAAGGGCGAGGCAAGATGAAGAACATG
GGGCCACTGCTGATGATGATGGCGGCCAAGACGGGCATGGTGGGAGCGCT
TCTGCTCAAAGGACTCTTCCTGCTGGCCGGCAAGGCTCTAATTGTCTCGA
AAATCGCCTTGCTGCTGGCGGTGATCATCTCACTGAAGAAGCTGCTCTCT
AGCAAGAAAACCATCGTGGAGGTGCCATCCCACCACGACAGCTATAGCTC
CGGGTGGTCGAGGGCCTTTGACGGGTTCGTGGAGGGACTTGTAGACGTGC
CCGCCGATATATTGGCCAAGGAGGTGCAGCACCAGCAGGAGCAGGCCCAA
AACATGGCTTACAGTGGCCAACAGCCGGGGAAAGTGGCGCAATAAAGCTA
GTGTTATGTATGTCATTAGATCAGGAACAAAAAAAAAAAAAAAAAA

FI03378.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
Osi3-RA 1308 Osi3-RA 180..1304 3..1127 5625 100 Plus
Osi3.a 1563 Osi3.a 180..1304 3..1127 5625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2042968..2043601 494..1127 3155 99.8 Plus
chr3R 27901430 chr3R 2041490..2041805 3..318 1580 100 Plus
chr3R 27901430 chr3R 2042290..2042471 314..495 895 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6217316..6217949 494..1127 3170 100 Plus
3R 32079331 3R 6215838..6216153 3..318 1580 100 Plus
3R 32079331 3R 6216638..6216819 314..495 895 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5958147..5958780 494..1127 3170 100 Plus
3R 31820162 3R 5956669..5956984 3..318 1580 100 Plus
3R 31820162 3R 5957469..5957650 314..495 895 99.4 Plus
Blast to na_te.dros performed on 2019-03-15 18:39:41 has no hits.

FI03378.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:40:28 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2041488..2041805 1..318 99 -> Plus
chr3R 2042295..2042470 319..494 100 -> Plus
chr3R 2042969..2043601 495..1128 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:44:06 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RA 1..867 229..1095 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:55 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RA 1..867 229..1095 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:26:38 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RA 1..867 229..1095 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:56 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RA 1..867 229..1095 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:56:20 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RA 1..867 229..1095 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:30:00 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RA 1..1127 1..1128 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:55 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RA 1..1127 1..1128 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:26:38 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RB 5..1131 1..1128 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:56 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RA 1..1127 1..1128 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:56:20 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
Osi3-RB 5..1131 1..1128 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:28 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6215836..6216153 1..318 99 -> Plus
3R 6216643..6216818 319..494 100 -> Plus
3R 6217317..6217949 495..1128 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:28 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6215836..6216153 1..318 99 -> Plus
3R 6216643..6216818 319..494 100 -> Plus
3R 6217317..6217949 495..1128 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:28 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6215836..6216153 1..318 99 -> Plus
3R 6216643..6216818 319..494 100 -> Plus
3R 6217317..6217949 495..1128 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:26:38 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2041558..2041875 1..318 99 -> Plus
arm_3R 2042365..2042540 319..494 100 -> Plus
arm_3R 2043039..2043671 495..1128 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:45 Download gff for FI03378.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5956667..5956984 1..318 99 -> Plus
3R 5957474..5957649 319..494 100 -> Plus
3R 5958148..5958780 495..1128 99   Plus

FI03378.pep Sequence

Translation from 228 to 1094

> FI03378.pep
MQTFKVCALLAFCFVLVSARGSKRRDGTVTISESERKNIEDFLLAKLKQN
CRQEDDRACKMVKMSIVMNHLYLNTRIDLGDRFKVTENGNISMVPDDPEV
NQLLSRSMGSDEETFALLMANKLWKFIRSRSLRYKFSENTDFVINSDPEG
SLNLGVSVRPLEALQEGRGKMKNMGPLLMMMAAKTGMVGALLLKGLFLLA
GKALIVSKIALLLAVIISLKKLLSSKKTIVEVPSHHDSYSSGWSRAFDGF
VEGLVDVPADILAKEVQHQQEQAQNMAYSGQQPGKVAQ*

FI03378.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16376-PA 290 GF16376-PA 1..290 1..288 1197 87.9 Plus
Dana\GF16379-PA 288 GF16379-PA 36..226 40..230 154 31.8 Plus
Dana\GF16380-PA 273 GF16380-PA 6..254 4..251 148 26.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13139-PA 288 GG13139-PA 1..288 1..288 1481 96.2 Plus
Dere\GG13151-PA 288 GG13151-PA 36..226 40..230 156 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14019-PA 284 GH14019-PA 1..284 1..288 785 58.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Osi3-PB 288 CG1150-PB 1..288 1..288 1446 100 Plus
Osi3-PA 288 CG1150-PA 1..288 1..288 1446 100 Plus
Osi7-PA 288 CG1153-PA 36..285 40..283 224 29.3 Plus
Osi12-PA 295 CG1154-PA 107..233 99..249 175 37.5 Plus
Osi8-PA 274 CG15591-PA 12..259 9..253 158 22.6 Plus
Osi14-PA 268 CG1155-PA 44..266 51..282 156 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24392-PA 282 GI24392-PA 1..282 1..288 940 63.3 Plus
Dmoj\GI24395-PA 288 GI24395-PA 39..251 43..243 149 31.8 Plus
Dmoj\GI24397-PA 232 GI24397-PA 127..231 163..282 145 36.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24056-PA 289 GL24056-PA 1..289 1..288 1261 89.3 Plus
Dper\GL24067-PA 269 GL24067-PA 45..267 51..282 162 28.2 Plus
Dper\GL24059-PA 287 GL24059-PA 36..250 40..243 154 32 Plus
Dper\GL24061-PA 232 GL24061-PA 54..218 86..249 145 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11035-PA 289 GA11035-PA 1..289 1..288 1267 89.6 Plus
Dpse\GA11054-PA 287 GA11054-PA 36..250 40..243 154 32 Plus
Dpse\GA13834-PA 232 GA13834-PA 54..218 86..249 147 30.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10864-PA 288 GM10864-PA 1..288 1..288 1513 99 Plus
Dsec\GM10868-PA 275 GM10868-PA 36..213 40..230 154 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19846-PA 288 GD19846-PA 1..288 1..288 1513 99 Plus
Dsim\GD19857-PA 268 GD19857-PA 44..266 51..282 151 27.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14248-PA 282 GJ14248-PA 1..282 1..288 925 61.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13034-PA 278 GK13034-PA 26..278 30..288 880 68.1 Plus
Dwil\GK13044-PA 268 GK13044-PA 44..229 51..244 145 29.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10187-PA 288 GE10187-PA 1..288 1..288 1498 96.9 Plus
Dyak\GE10190-PA 288 GE10190-PA 36..226 40..230 156 31.8 Plus
Dyak\GE10198-PA 268 GE10198-PA 44..266 51..282 150 27.4 Plus

FI03378.hyp Sequence

Translation from 228 to 1094

> FI03378.hyp
MQTFKVCALLAFCFVLVSARGSKRRDGTVTISESERKNIEDFLLAKLKQN
CRQEDDRACKMVKMSIVMNHLYLNTRIDLGDRFKVTENGNISMVPDDPEV
NQLLSRSMGSDEETFALLMANKLWKFIRSRSLRYKFSENTDFVINSDPEG
SLNLGVSVRPLEALQEGRGKMKNMGPLLMMMAAKTGMVGALLLKGLFLLA
GKALIVSKIALLLAVIISLKKLLSSKKTIVEVPSHHDSYSSGWSRAFDGF
VEGLVDVPADILAKEVQHQQEQAQNMAYSGQQPGKVAQ*

FI03378.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
Osi3-PB 288 CG1150-PB 1..288 1..288 1446 100 Plus
Osi3-PA 288 CG1150-PA 1..288 1..288 1446 100 Plus
Osi7-PA 288 CG1153-PA 36..285 40..283 224 29.3 Plus
Osi12-PA 295 CG1154-PA 107..233 99..249 175 37.5 Plus
Osi8-PA 274 CG15591-PA 12..259 9..253 158 22.6 Plus