Clone FI03494 Report

Search the DGRC for FI03494

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:34
Well:94
Vector:pFlc-1
Associated Gene/TranscriptTaf8-RA
Protein status:FI03494.pep: Imported from assembly
Sequenced Size:1392

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Taf8 2008-12-18 5.12 accounting

Clone Sequence Records

FI03494.complete Sequence

1392 bp assembled on 2010-02-11

> FI03494.complete
AGTGCCGAACAGTGCCATCACTAGCCGCTAAAGTGGCAATATTCACTGCG
GTTTCTACTTTAGCATAAACAAATTGAATTCTGTCTCCATGGAGAAGGTG
GAGGCGGTAACAGTGTCCAATGTTGATCCCTATAGGCGGATCCTAAACAA
GGTGGTGTCCCAGCTGCTATTGGACAAGGGGGCCGGCCAAGCGAGCAACC
ACAGCCTGGAGACGCTCACCCAGATGCTGCAGGCGTTGATCTGGGAGATC
GGCAATTCGGCGCATAACTACTGCGAGCTAAGTGGACGCACGATGCCCAC
CGTGGGCGATGTCAGTTTGGCCCTGATTAACATGGGCATTTCGATCTCCA
ATTTGGATCCGTACATGCGCAAGGAGACGCACGTGCCCATTCCACTGCCC
CCACAGCAGACGCAGCAGCGCCCGCTGAGTCTGCTGCAAGCGGGCATCAA
GGCCCCGCATCCCCACTACGTGCCCAGCTACTTCCCTCCCATGCCCGATC
CGCACGCCTACATACGGACGCCCACGCACAAGCAGCCCGTAACAGAGTAC
GAGGCCATCAGGGAGAAGGCCGCCTGCCAGAAGCGGGACATCGAGAAGGC
GCTCACAAAGTTCCTCTGCAAGACCACGGAGACGAACAACCTCTTTCCCA
CCGAGGACAACATGTTTCCTTTAATTGCCTGCAAACCGGCCTTTCCTCCC
TATGCAGCCGCTTTAAATCCCACAGATCAGGTGTTTGACTTCGAGGAGCT
GGAGTACCACTATCTGGTGGCCAATCGCACAGAAGATGAGCCCAGCAAAG
ACGACGGCGAAGAGGGCGATAGCGAAAACGAGGAGATAGATGGCGAAGAG
GGCGATAGCGAAAACGAGGAGATGGATGGCGACAAATCCAAAGAGGAGAA
GCCCGAGCTGGATATCAAGCCCAATTCCAACACAAACAAGGCCATTTTGG
AGAACCCCAACATCGATAATCCCTATTTGCGGGCGGCTACTCTGCCCAAG
CGATCCAAAAATTGCCCCACACCCGGAACCATGCCCAGCAGGAGTCTGGC
CACCACGGCGCCAACGATACGAACGCCCTCCACTCTAGAGATAACCAAAA
CTAACCTTTAAGAGTAGCAGGCGTTTTTAATTATGGTTTGAAAATGTAAA
CACTCCTGTTTTCTTTAAATTTAAAAAATTAAAAAATTTAAAGTGTAGTT
TTAGGTTCAAGGACTAATATATTTTATTTTATACTTACATATTTGGAATC
TTTAAGTTTGAACTGAAGACATTGTATAGGGCCAATTTCCTCAAAATGGC
ATAATATTTCGTGTTATATATTTAAATAATAAAATAAATGGGTACTCCAG
CAACGATCTGTGCTGGAAGATCTGCAAAAAAAAAAAAAAAAA

FI03494.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Taf8-RA 1399 Taf8-RA 54..899 1..846 4215 99.8 Plus
Taf8-RA 1399 Taf8-RA 859..1395 842..1378 2685 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17992262..17992795 842..1375 2655 99.8 Plus
chrX 22417052 chrX 17991581..17992015 237..671 2175 100 Plus
chrX 22417052 chrX 17991285..17991520 1..236 1180 100 Plus
chrX 22417052 chrX 17992071..17992199 672..800 645 100 Plus
chrX 22417052 chrX 17992255..17992302 799..846 225 97.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18102949..18103485 842..1378 2685 100 Plus
X 23542271 X 18102268..18102702 237..671 2175 100 Plus
X 23542271 X 18101972..18102207 1..236 1180 100 Plus
X 23542271 X 18102758..18102886 672..800 645 100 Plus
X 23542271 X 18102942..18102989 799..846 225 97.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18111047..18111583 842..1378 2685 100 Plus
X 23527363 X 18110366..18110800 237..671 2175 100 Plus
X 23527363 X 18110070..18110305 1..236 1180 100 Plus
X 23527363 X 18110856..18110984 672..800 645 100 Plus
X 23527363 X 18111040..18111087 799..846 225 97.9 Plus
Blast to na_te.dros performed on 2019-03-16 05:14:34 has no hits.

FI03494.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:15:29 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17991285..17991520 1..236 100 -> Plus
chrX 17991581..17992015 237..671 100 -> Plus
chrX 17992071..17992199 672..800 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 17:21:22 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 1..758 89..846 99 == Plus
Taf8-RA 759..987 883..1111 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:26:25 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 1..758 89..846 99 == Plus
Taf8-RA 759..987 883..1111 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:16:32 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 1..758 89..846 99 == Plus
Taf8-RA 759..987 883..1111 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:34 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 1..758 89..846 99 == Plus
Taf8-RA 759..987 883..1111 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 17:21:21 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 1..846 1..846 99 == Plus
Taf8-RA 847..1339 883..1375 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:26:25 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 1..846 1..846 99 == Plus
Taf8-RA 847..1339 883..1375 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:16:32 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 3..848 1..846 99 == Plus
Taf8-RA 849..1341 883..1375 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-24 18:42:11 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 1..846 1..846 99 == Plus
Taf8-RA 847..1339 883..1375 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:34 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
Taf8-RA 3..848 1..846 99 == Plus
Taf8-RA 849..1341 883..1375 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:29 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
X 18101972..18102207 1..236 100 -> Plus
X 18102268..18102702 237..671 100 -> Plus
X 18102758..18102886 672..800 100 == Plus
X 18102949..18103482 842..1375 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:29 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
X 18101972..18102207 1..236 100 -> Plus
X 18102268..18102702 237..671 100 -> Plus
X 18102758..18102886 672..800 100 == Plus
X 18102949..18103482 842..1375 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:29 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
X 18101972..18102207 1..236 100 -> Plus
X 18102268..18102702 237..671 100 -> Plus
X 18102758..18102886 672..800 100 == Plus
X 18102949..18103482 842..1375 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:16:32 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17996791..17996919 672..800 100 == Plus
arm_X 17996005..17996240 1..236 100 -> Plus
arm_X 17996301..17996735 237..671 100 -> Plus
arm_X 17996982..17997515 842..1375 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:02 Download gff for FI03494.complete
Subject Subject Range Query Range Percent Splice Strand
X 18110070..18110305 1..236 100 -> Plus
X 18110366..18110800 237..671 100 -> Plus
X 18110856..18110984 672..800 100 == Plus
X 18111047..18111580 842..1375 100   Plus

FI03494.pep Sequence

Translation from 88 to 1110

> FI03494.pep
MEKVEAVTVSNVDPYRRILNKVVSQLLLDKGAGQASNHSLETLTQMLQAL
IWEIGNSAHNYCELSGRTMPTVGDVSLALINMGISISNLDPYMRKETHVP
IPLPPQQTQQRPLSLLQAGIKAPHPHYVPSYFPPMPDPHAYIRTPTHKQP
VTEYEAIREKAACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIACKP
AFPPYAAALNPTDQVFDFEELEYHYLVANRTEDEPSKDDGEEGDSENEEI
DGEEGDSENEEMDGDKSKEEKPELDIKPNSNTNKAILENPNIDNPYLRAA
TLPKRSKNCPTPGTMPSRSLATTAPTIRTPSTLEITKTNL*

FI03494.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19371-PA 322 GF19371-PA 1..319 1..337 1456 83.7 Plus
Dana\GF24194-PA 313 GF24194-PA 1..217 12..217 160 27.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19150-PA 328 GG19150-PA 1..328 1..340 1540 89.7 Plus
Dere\GG13239-PA 263 GG13239-PA 1..259 12..254 203 27.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:51:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17580-PA 332 GH17580-PA 1..328 1..336 1288 71.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
Taf8-PA 328 CG7128-PA 1..328 1..340 1710 96.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:51:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15178-PA 331 GI15178-PA 5..331 4..340 1347 76.2 Plus
Dmoj\GI13306-PA 799 GI13306-PA 3..220 14..217 186 26.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14948-PA 323 GL14948-PA 1..320 1..337 1344 76.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20122-PA 323 GA20122-PA 1..320 1..337 1342 76.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22880-PA 330 GM22880-PA 1..328 1..340 1681 93.2 Plus
Dsec\GM22142-PA 275 GM22142-PA 7..262 18..254 158 24.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12120-PA 275 GD12120-PA 1..262 12..254 168 24.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17059-PA 332 GJ17059-PA 1..331 1..339 1434 80.2 Plus
Dvir\GJ12076-PA 304 GJ12076-PA 1..224 12..224 166 26.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17025-PA 321 GK17025-PA 1..321 1..340 1400 80 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17709-PA 328 GE17709-PA 1..328 1..340 1591 89.1 Plus
Dyak\GE22337-PA 278 GE22337-PA 1..268 12..255 176 24.1 Plus
Dyak\GE22713-PA 278 GE22713-PA 1..268 12..255 174 24.3 Plus

FI03494.hyp Sequence

Translation from 88 to 816

> FI03494.hyp
MEKVEAVTVSNVDPYRRILNKVVSQLLLDKGAGQASNHSLETLTQMLQAL
IWEIGNSAHNYCELSGRTMPTVGDVSLALINMGISISNLDPYMRKETHVP
IPLPPQQTQQRPLSLLQAGIKAPHPHYVPSYFPPMPDPHAYIRTPTHKQP
VTEYEAIREKAACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIACKP
AFPPYAAALNPTDQVFDFEELEYHYLVANRTEDEPSKGRRGR*

FI03494.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Taf8-PA 328 CG7128-PA 1..237 1..237 1256 100 Plus