Clone FI04716 Report

Search the DGRC for FI04716

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:47
Well:16
Vector:pFlc-1
Associated Gene/TranscriptRoe1-RA
Protein status:FI04716.pep: gold
Sequenced Size:1089

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Roe1 2008-12-18 5.12 accounting

Clone Sequence Records

FI04716.complete Sequence

1089 bp assembled on 2008-11-04

GenBank Submission: BT050467.1

> FI04716.complete
ACTATCGAACACACATCGATTGTTGAGAGAGCTGTGAAGCCGACGATTTT
ACGTCAAAAGCGGAATAAGTTTATTTAACGTACGAAAAAGCTAAGCATAA
TGTCAGCAAAGGCAGCCTTACCACTGCAGATGTTTGGCCGGCGACTCGTC
CACCTGAGGTCATCGGTCACTTCTCAAAATATGAGTGCCCTGCGTTTGTA
CAGCACAGAGAAACAGCCGGAAGAAGCGACAGAGCAGAAGGCCACCGAAT
CGTCGCCAGAAGTTGAGAAACTCACCAAGGAACTGGCCGCCGCCAAGGAG
CAGAATGCCGAGCTAATGGACAAATACAAGCGTTCGCTAGCCGACAGCGA
AAACATGAGGAACCGACTGAACAAACAGATCAGCGACGCCAAGATCTTTG
GCATCCAGAGCTTCTGCAAGGATCTGCTCGAGGTGGCGGACACACTGGGA
CATGCCACACAGGCGGTGCCCAAGGATAAGCTCAGCGGCAATGCTGATTT
GAAGAACCTGTACGAGGGCCTCACCATGACGCGCGCCTCGCTGCTGCAGG
TGTTCAAGCGACACGGACTGGAGCCACTGGATCCCATCAACCAGAAGTTC
GACCCCAATCAGCACGAGGCGCTGTTCCAGAAGGAGGACAAGACCGTCGA
GCCCAACACCGTGGTGGAGGTGACCAAGCTGGGCTACAAACTGCACGAGC
GTTGCATACGTCCGGCCTTGGTGGGCGTGTCGAAGTGTTGATAGCCATGC
GGCTGCCCAGAGGCATGTAAAATTCCCAGTACTCCCCCCCCCCCCTAAAC
CAATTTACATGGCGTGTGTCTCTCAATTGTTTGCAATTTGTTTTCCGCTG
CAAAATTCATGTACGTAAACCCTGTGTAAATACAACCTATCCCACAAACG
CATCCTTCGGGCAAAGCTTGCGAATTTAGAATTCCTCCTAGTTTCTAAGA
GATCTGTGACTGGATTTGATGGCCACAATTTGTACCATACGCGTGGCCAT
CGAGTGTTCCACTTTAAGGTTTAATTACGATAATAAAACATGTTTTAGTT
TGTTGAAATAAAAAAAAAAAAAAGAAAAAAAAAAAAAAA

FI04716.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Roe1-RA 1184 Roe1-RA 84..1144 1..1060 5265 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9442326..9442908 479..1060 2865 99.8 Plus
chr2R 21145070 chr2R 9441686..9441982 184..480 1485 100 Plus
chr2R 21145070 chr2R 9441383..9441567 1..185 925 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13555025..13555607 479..1060 2865 99.8 Plus
2R 25286936 2R 13554385..13554681 184..480 1485 100 Plus
2R 25286936 2R 13554082..13554266 1..185 925 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13556224..13556806 479..1060 2875 99.8 Plus
2R 25260384 2R 13555584..13555880 184..480 1485 100 Plus
2R 25260384 2R 13555281..13555465 1..185 925 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:39:33 has no hits.

FI04716.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:40:24 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9441383..9441567 1..185 100 -> Plus
chr2R 9441688..9441982 186..480 100 -> Plus
chr2R 9442328..9442907 481..1059 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:56 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:03 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:38:44 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:32 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 1..642 100..741 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:16 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 1..1060 1..1059 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:03 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 1..1060 1..1059 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:38:44 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 6..1065 1..1059 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 12:41:39 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 1..1060 1..1059 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:32 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
Roe1-RA 6..1065 1..1059 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:24 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13554082..13554266 1..185 100 -> Plus
2R 13554387..13554681 186..480 100 -> Plus
2R 13555027..13555606 481..1059 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:24 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13554082..13554266 1..185 100 -> Plus
2R 13554387..13554681 186..480 100 -> Plus
2R 13555027..13555606 481..1059 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:24 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13554082..13554266 1..185 100 -> Plus
2R 13554387..13554681 186..480 100 -> Plus
2R 13555027..13555606 481..1059 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:38:44 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9441587..9441771 1..185 100 -> Plus
arm_2R 9441892..9442186 186..480 100 -> Plus
arm_2R 9442532..9443111 481..1059 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:14 Download gff for FI04716.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13555586..13555880 186..480 100 -> Plus
2R 13556226..13556805 481..1059 99   Plus
2R 13555281..13555465 1..185 100 -> Plus

FI04716.pep Sequence

Translation from 99 to 740

> FI04716.pep
MSAKAALPLQMFGRRLVHLRSSVTSQNMSALRLYSTEKQPEEATEQKATE
SSPEVEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLNKQISDAKIF
GIQSFCKDLLEVADTLGHATQAVPKDKLSGNADLKNLYEGLTMTRASLLQ
VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHE
RCIRPALVGVSKC*

FI04716.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13703-PA 224 GF13703-PA 1..224 1..213 994 84.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20391-PA 215 GG20391-PA 1..215 1..213 1069 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23157-PA 215 GH23157-PA 6..215 16..213 808 73.3 Plus
Dgri\GH24729-PA 200 GH24729-PA 1..199 11..212 665 63.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Roe1-PA 213 CG6155-PA 1..213 1..213 1075 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18336-PA 216 GI18336-PA 29..216 31..212 788 80.3 Plus
Dmoj\GI14884-PA 250 GI14884-PA 72..249 35..212 658 68.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17413-PA 227 GL17413-PA 1..227 1..213 859 75.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19397-PA 227 GA19397-PA 1..227 1..213 867 76.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21478-PA 213 GM21478-PA 1..213 1..213 1106 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10974-PA 213 GD10974-PA 1..213 1..213 1110 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19762-PA 202 GJ19762-PA 1..202 11..213 830 77.8 Plus
Dvir\GJ15316-PA 238 GJ15316-PA 1..237 11..212 722 62 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15968-PA 209 GK15968-PA 1..209 1..212 881 78.8 Plus
Dwil\GK11616-PA 223 GK11616-PA 1..223 1..212 774 65.9 Plus
Dwil\GK23032-PA 170 GK23032-PA 6..170 48..212 750 84.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12552-PA 215 GE12552-PA 1..215 1..213 1072 94 Plus

FI04716.hyp Sequence

Translation from 99 to 740

> FI04716.hyp
MSAKAALPLQMFGRRLVHLRSSVTSQNMSALRLYSTEKQPEEATEQKATE
SSPEVEKLTKELAAAKEQNAELMDKYKRSLADSENMRNRLNKQISDAKIF
GIQSFCKDLLEVADTLGHATQAVPKDKLSGNADLKNLYEGLTMTRASLLQ
VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHE
RCIRPALVGVSKC*

FI04716.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Roe1-PA 213 CG6155-PA 1..213 1..213 1075 100 Plus