Clone FI05212 Report

Search the DGRC for FI05212

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:52
Well:12
Vector:pOT2
Associated Gene/TranscriptSodh-1-RA
Protein status:FI05212.pep: gold
Sequenced Size:1404

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Sodh-1 2008-12-18 5.12 accounting

Clone Sequence Records

FI05212.complete Sequence

1404 bp assembled on 2008-09-17

GenBank Submission: BT044539.1

> FI05212.complete
GCACATGCAAACAAACACACCTTTTAAACACACATCCAGCTGTACTCAAG
TGGTGATAAGGCTGATAACATTTGACCACAAACGATAGTGGGTGTGGTGC
CTATTATTTTCCTATCGCTGGTCCTACGTCACGCTGATAACTGATAACCG
CGAATTCAGAAGTCCACTAGTGTAAGGTTTAAAATATTTGAATCAGTTGT
GAATCGGCTATTCGAGCGTGTGGTTATTAGAGCTCTCAAATAATTCAATT
GACACATAGAAATGGCCAAGGATAATCTAACAGCAGTGCTGCACGGCATT
GAGGACATGCGATTGGAGCAACGTCCTATTCCAGAGATTGCTGATGATGA
GGTTCTCCTGGCCATGGATAGTGTTGGCATTTGCGGCTCTGATGTACACT
ACCTTGCACACGGACGCATTGGCGACTTTGTGCTCACTAAGCCCATGATT
ATTGGCCACGAGTCCGCCGGCGTGGTGGCTAAGCTGGGCAAGAAGGTGAC
CACACTGAAGGTCGGCGACCGCGTGGCCATCGAACCGGGCGTACCCTGCC
GTAAGTGCGACCATTGCAAGCAGGGCAAATACAACCTGTGCCCCGGAATG
GTCTTCTGTGCCACGCCCCCCTACGACGGCAACCTCACCCGCTACTACAA
GCATGCGGCGGACTTCTGCTTCAAGCTGCCCGACCACGTCACCATGGAGG
AGGGCGCCCTGCTCGAGCCTCTGTCTGTGGGCGTGCATGCCTGCAAGCGG
GCGGAGGTCACCCTGGGCTCAAAAGTTCTCATCCTGGGAGCAGGACCCAT
TGGCCTGGTCACTTTAATGGCTGCTCAAGCCATGGGTGCGTCTGAGATCC
TCATTACGGATCTTGTGCAGCAACGCCTCGATGTAGCTAAAGAGCTAGGT
GCAACTCACACCCTCCTGCTGAAACGGGATCAGACCGCCGAGGAGACGGC
GGTGCTCGTCCAAAAAACGATGGGCGGTCAGCCGGACAAGTCCATCGACT
GCTGTGGAGCAGAGAGCAGTGCCCGACTGGCCATCTTCGCCACTCGTTCC
GGTGGCATTGTGGTGGTGGTGGGCATGGGAGCAGCTGAGATCAAGTTGCC
CCTAATTAATGCCCTGGCCCGGGAAGTGGACATCCGCGGCGTCTTCCGCT
ACTGCAATGACTATGCCGCTGCCCTGGCCCTTGTCGCCTCCGGAAAGGTG
AATGTTAAGCGTCTGGTGACCCACCATTTCGACATCAAGGAAACGGCAAA
GGCGTTTGAAACGTCACGAAAGGGACTGGGTGGTGCCATCAAGGTCATGA
TCCACGTCCAGCCCAGAGACACCAACAATCCTCGCAAATTCTAAACATTT
GTATAAGTCGTTAAAAATATAGTATAGAGAACCCAGTAAAAAAAAAAAAA
AAAA

FI05212.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Sodh-1-RA 1430 Sodh-1-RA 1..1388 1..1388 6940 100 Plus
Sodh-2-RA 1460 Sodh-2-RA 189..659 274..744 1215 83.8 Plus
Sodh-2.b 1448 Sodh-2.b 218..647 315..744 1100 83.7 Plus
Sodh-2-RA 1460 Sodh-2-RA 896..1174 981..1259 690 83.1 Plus
Sodh-2.b 1448 Sodh-2.b 884..1162 981..1259 690 83.1 Plus
Sodh-2-RA 1460 Sodh-2-RA 678..862 763..947 355 79.4 Plus
Sodh-2.b 1448 Sodh-2.b 666..850 763..947 355 79.4 Plus
Sodh-2-RA 1460 Sodh-2-RA 1194..1243 1279..1328 160 88 Plus
Sodh-2.b 1448 Sodh-2.b 1182..1231 1279..1328 160 88 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2879155..2879626 349..820 2360 100 Plus
chr3R 27901430 chr3R 2878363..2878678 1..316 1580 100 Plus
chr3R 27901430 chr3R 2880342..2880568 1161..1387 1135 100 Plus
chr3R 27901430 chr3R 2879889..2880109 819..1039 1105 100 Plus
chr3R 27901430 chr3R 6702436..6702899 349..812 1090 82.3 Plus
chr3R 27901430 chr3R 2880167..2880288 1039..1160 610 100 Plus
chr3R 27901430 chr3R 6702965..6703185 819..1039 460 80.5 Plus
chr3R 27901430 chr3R 6703420..6703586 1162..1328 295 78.4 Plus
chr3R 27901430 chr3R 6703239..6703360 1039..1160 235 79.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7053127..7053598 349..820 2360 100 Plus
3R 32079331 3R 7052335..7052650 1..316 1580 100 Plus
3R 32079331 3R 7054315..7054542 1161..1388 1140 100 Plus
3R 32079331 3R 7053862..7054082 819..1039 1105 100 Plus
3R 32079331 3R 10876899..10877362 349..812 1090 82.3 Plus
3R 32079331 3R 7054140..7054261 1039..1160 610 100 Plus
3R 32079331 3R 10877428..10877648 819..1039 460 80.5 Plus
3R 32079331 3R 10877883..10878049 1162..1328 295 78.4 Plus
3R 32079331 3R 10877702..10877823 1039..1160 235 79.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6793958..6794429 349..820 2360 100 Plus
3R 31820162 3R 6793166..6793481 1..316 1580 100 Plus
3R 31820162 3R 6795146..6795373 1161..1388 1140 100 Plus
3R 31820162 3R 6794693..6794913 819..1039 1105 100 Plus
3R 31820162 3R 10617730..10618125 349..744 1035 84 Plus
3R 31820162 3R 6794971..6795092 1039..1160 610 100 Plus
3R 31820162 3R 10618259..10618387 819..947 270 80.6 Plus
3R 31820162 3R 10618421..10618479 981..1039 265 96.6 Plus
3R 31820162 3R 10618533..10618654 1039..1160 235 79.5 Plus
3R 31820162 3R 10618714..10618811 1162..1259 205 80.6 Plus
3R 31820162 3R 6793538..6793572 315..349 175 100 Plus
3R 31820162 3R 10618831..10618880 1279..1328 160 88 Plus
Blast to na_te.dros performed on 2019-03-16 07:23:09 has no hits.

FI05212.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:24:00 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2878363..2878677 1..315 100 -> Plus
chr3R 2878736..2878769 316..349 100 -> Plus
chr3R 2879156..2879625 350..819 100 -> Plus
chr3R 2879890..2880108 820..1038 100 -> Plus
chr3R 2880167..2880288 1039..1160 100 -> Plus
chr3R 2880342..2880568 1161..1387 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:24 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1083 262..1344 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:08:10 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1083 262..1344 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:02 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1083 262..1344 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:30:45 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1083 262..1344 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:05:31 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1387 1..1387 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:08:10 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1387 1..1387 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:02 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1387 1..1387 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-19 10:47:10 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1387 1..1387 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:30:45 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
Sodh-1-RA 1..1387 1..1387 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:00 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7053863..7054081 820..1038 100 -> Plus
3R 7054140..7054261 1039..1160 100 -> Plus
3R 7052335..7052649 1..315 100 -> Plus
3R 7052708..7052741 316..349 100 -> Plus
3R 7053128..7053597 350..819 100 -> Plus
3R 7054315..7054541 1161..1387 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:00 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7053863..7054081 820..1038 100 -> Plus
3R 7054140..7054261 1039..1160 100 -> Plus
3R 7052335..7052649 1..315 100 -> Plus
3R 7052708..7052741 316..349 100 -> Plus
3R 7053128..7053597 350..819 100 -> Plus
3R 7054315..7054541 1161..1387 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:00 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7053863..7054081 820..1038 100 -> Plus
3R 7054140..7054261 1039..1160 100 -> Plus
3R 7052335..7052649 1..315 100 -> Plus
3R 7052708..7052741 316..349 100 -> Plus
3R 7053128..7053597 350..819 100 -> Plus
3R 7054315..7054541 1161..1387 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:02 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2878057..2878371 1..315 100 -> Plus
arm_3R 2878430..2878463 316..349 100 -> Plus
arm_3R 2878850..2879319 350..819 100 -> Plus
arm_3R 2879585..2879803 820..1038 100 -> Plus
arm_3R 2879862..2879983 1039..1160 100 -> Plus
arm_3R 2880037..2880263 1161..1387 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:00:25 Download gff for FI05212.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6794694..6794912 820..1038 100 -> Plus
3R 6794971..6795092 1039..1160 100 -> Plus
3R 6795146..6795372 1161..1387 100   Plus
3R 6793166..6793480 1..315 100 -> Plus
3R 6793539..6793572 316..349 100 -> Plus
3R 6793959..6794428 350..819 100 -> Plus

FI05212.pep Sequence

Translation from 261 to 1343

> FI05212.pep
MAKDNLTAVLHGIEDMRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAH
GRIGDFVLTKPMIIGHESAGVVAKLGKKVTTLKVGDRVAIEPGVPCRKCD
HCKQGKYNLCPGMVFCATPPYDGNLTRYYKHAADFCFKLPDHVTMEEGAL
LEPLSVGVHACKRAEVTLGSKVLILGAGPIGLVTLMAAQAMGASEILITD
LVQQRLDVAKELGATHTLLLKRDQTAEETAVLVQKTMGGQPDKSIDCCGA
ESSARLAIFATRSGGIVVVVGMGAAEIKLPLINALAREVDIRGVFRYCND
YAAALALVASGKVNVKRLVTHHFDIKETAKAFETSRKGLGGAIKVMIHVQ
PRDTNNPRKF*

FI05212.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17192-PA 360 GF17192-PA 1..360 1..360 1709 90.3 Plus
Dana\GF18841-PA 360 GF18841-PA 1..360 1..360 1673 88.9 Plus
Dana\GF17631-PA 630 GF17631-PA 292..612 15..343 429 31.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13709-PA 360 GG13709-PA 1..360 1..360 1854 97.8 Plus
Dere\GG17814-PA 360 GG17814-PA 1..360 1..360 1680 89.7 Plus
Dere\GG23658-PA 1210 GG23658-PA 888..1201 24..343 423 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14504-PA 360 GH14504-PA 1..360 1..360 1592 84.7 Plus
Dgri\GH17060-PA 301 GH17060-PA 1..268 62..335 368 30.2 Plus
Dgri\GH23194-PA 233 GH23194-PA 1..232 62..299 325 31 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Sodh-1-PB 360 CG1982-PB 1..360 1..360 1853 100 Plus
Sodh-1-PA 360 CG1982-PA 1..360 1..360 1853 100 Plus
Sodh-2-PA 360 CG4649-PA 1..360 1..360 1688 90.3 Plus
CG4836-PB 1214 CG4836-PB 892..1205 24..343 423 31.5 Plus
CG4836-PC 1217 CG4836-PC 895..1208 24..343 423 31.5 Plus
CG4836-PE 1224 CG4836-PE 902..1215 24..343 423 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22936-PA 360 GI22936-PA 1..360 1..360 1573 84.2 Plus
Dmoj\GI22934-PA 360 GI22934-PA 1..360 1..360 1553 83.1 Plus
Dmoj\GI22938-PA 638 GI22938-PA 279..638 1..360 1541 81.9 Plus
Dmoj\GI22439-PA 1392 GI22439-PA 1053..1360 19..336 373 27.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21779-PA 360 GL21779-PA 1..360 1..360 1628 86.9 Plus
Dper\GL12569-PA 360 GL12569-PA 1..360 1..360 1602 86.9 Plus
Dper\GL12549-PA 282 GL12549-PA 38..282 85..360 992 75 Plus
Dper\GL12081-PA 1304 GL12081-PA 971..1299 22..360 390 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26401-PA 360 GA26401-PA 1..360 1..360 1626 86.9 Plus
Dpse\GA27556-PB 346 GA27556-PB 1..346 1..360 1475 81.7 Plus
Dpse\GA27556-PA 329 GA27556-PA 1..329 1..360 1428 79.4 Plus
Dpse\GA27549-PB 329 GA27549-PB 1..329 1..360 1315 75.3 Plus
Dpse\GA26187-PB 1311 GA26187-PB 978..1293 22..347 376 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10921-PA 360 GM10921-PA 1..360 1..360 1866 98.6 Plus
Dsec\GM23911-PA 360 GM23911-PA 1..360 1..360 1677 90 Plus
Dsec\GM17688-PA 1191 GM17688-PA 884..1147 24..297 354 31.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19902-PA 360 GD19902-PA 1..360 1..360 1866 98.6 Plus
Dsim\GD18723-PA 360 GD18723-PA 1..360 1..360 1669 89.7 Plus
Dsim\GD19331-PA 1205 GD19331-PA 883..1196 24..343 412 30.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15399-PA 360 GJ15399-PA 1..360 1..360 1573 84.2 Plus
Dvir\GJ23219-PA 360 GJ23219-PA 1..360 1..360 1565 83.6 Plus
Dvir\GJ23218-PA 360 GJ23218-PA 1..360 1..360 1543 83.1 Plus
Dvir\GJ11002-PA 1389 GJ11002-PA 1055..1381 19..355 387 29.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12254-PA 360 GK12254-PA 1..360 1..360 1625 86.4 Plus
Dwil\GK13991-PA 363 GK13991-PA 7..363 4..360 1618 88.2 Plus
Dwil\GK22367-PA 1682 GK22367-PA 1353..1650 29..336 404 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24888-PA 360 GE24888-PA 1..360 1..360 1837 96.9 Plus
Dyak\GE26061-PA 360 GE26061-PA 1..360 1..360 1667 89.4 Plus
Dyak\GE14970-PA 216 GE14970-PA 1..216 145..360 1085 97.7 Plus
Dyak\GE25640-PA 1215 GE25640-PA 893..1206 24..343 426 31.8 Plus

FI05212.hyp Sequence

Translation from 261 to 1343

> FI05212.hyp
MAKDNLTAVLHGIEDMRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAH
GRIGDFVLTKPMIIGHESAGVVAKLGKKVTTLKVGDRVAIEPGVPCRKCD
HCKQGKYNLCPGMVFCATPPYDGNLTRYYKHAADFCFKLPDHVTMEEGAL
LEPLSVGVHACKRAEVTLGSKVLILGAGPIGLVTLMAAQAMGASEILITD
LVQQRLDVAKELGATHTLLLKRDQTAEETAVLVQKTMGGQPDKSIDCCGA
ESSARLAIFATRSGGIVVVVGMGAAEIKLPLINALAREVDIRGVFRYCND
YAAALALVASGKVNVKRLVTHHFDIKETAKAFETSRKGLGGAIKVMIHVQ
PRDTNNPRKF*

FI05212.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Sodh-1-PB 360 CG1982-PB 1..360 1..360 1853 100 Plus
Sodh-1-PA 360 CG1982-PA 1..360 1..360 1853 100 Plus
Sodh-2-PA 360 CG4649-PA 1..360 1..360 1688 90.3 Plus
CG4836-PB 1214 CG4836-PB 892..1205 24..343 423 31.5 Plus
CG4836-PC 1217 CG4836-PC 895..1208 24..343 423 31.5 Plus