Clone FI05704 Report

Search the DGRC for FI05704

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:57
Well:4
Vector:pOT2
Associated Gene/TranscriptLsm11-RA
Protein status:FI05704.pep: gold
Sequenced Size:1093

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lsm11 2008-08-15 Release 5.9 accounting
Lsm11 2008-12-18 5.12 accounting

Clone Sequence Records

FI05704.complete Sequence

1093 bp assembled on 2008-07-17

GenBank Submission: BT044235.1

> FI05704.complete
CCTGTTGCCTTTTAAGCGGAAAAAGAAAAAAATTTAAGGTTCTTTGTTCT
ATCAGACTTCTATCGGCAGACTTCGGGAATCAGTGTCATGGAATCGAGGG
ACCGGAAAACTTCGAATGAGGACGACTCGTCGGAAATCTCCGAATTGGAT
GTGGGCAGTGATAGGTTTAATCCTCTGCGAGCGTTATACGAACCCAATTT
TAGGGTGACCGATGCTGTTCCAAAGGTCATCTACCAGAATCTGGCTGCCT
TCGAGAGTGCACTTAAAAAATTCGGCATCTGGCAGCTGAACAAGCGCCAA
AAGCCGGGATCCGCAGAAGGAGGAGATCAGGGGACATCGAAAAAGGCTTC
CACTTCCGAGGCTGTAGATATTCTACCTCCTGAGCGACGTTTTGAGCCGC
ACCAGATGCCTACCACTAGTAGCAGAAAGAAGCATCATCGAAATATTTTC
ACCTACATGGAGGCAGCTGTCGGTCCATTGGAACTCCTAACGAAGTGCAT
ATCCCCTGCTAGCCACAATGAATCCAACGAAAGGAGAAGAGTTCGGGTGG
TGATTCGCAAACACGGATCGGTGGGCGGCAGTGTCGAGGGTGAACTGTTG
GCCTTTGACAAGCAGTGGAACCTCCTACTGAGGAATGTTACCGAAACCTG
GAAGCGACGAAAGTACAATTACGGAGAGCAAAACATATGCGACACACCTG
TTGATTGCACAGGCCGCCTCAAGGAGTTGGGTATCACTCTTCCCAGGACT
GTAGTCAAAAATCTAAACCGAAAAAACGTGGAGATTCGGCGAGAGCTCCC
ACAGATTTTAATACGCGGCGAGAATGTGGTTCTAGTTAGTTTAATACCAA
CAAAATAGTGTATAGCTTATTAAAAGTCACCTCAGATAAAAATCGCGTAG
GGTTCTACTTAAAAAACTACAGCAGTCTCTATTAAAGTAGCTAAGAATAT
ATGTAAATTATTGATATATATAATTAAGTTACGCTACAATGTATACAAAT
TAAGTTATATGATATATTTCCATTTAAGGTTTGAAATCGTTTTACTTTTA
AAGAAATTTAAACTACTAAAAAAAAAAAAAAAAAAAAAAAAAA

FI05704.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Lsm11-RA 1068 Lsm11-RA 1..1068 1..1068 5325 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5725910..5726976 1067..1 5320 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:15:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9838433..9839500 1068..1 5325 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9839632..9840699 1068..1 5325 99.9 Minus
Blast to na_te.dros performed on 2019-03-16 13:34:05 has no hits.

FI05704.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:34:58 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5725910..5726976 1..1067 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:51:21 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..771 88..858 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:52 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..771 88..858 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:29:57 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..771 88..858 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:14 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..771 88..858 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:58 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..771 88..858 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:29:05 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..1067 1..1067 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:52 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..1067 1..1067 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:29:57 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..1067 1..1067 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:15 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..1067 1..1067 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:58 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 1..1067 1..1067 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:34:58 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9838434..9839500 1..1067 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:34:58 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9838434..9839500 1..1067 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:34:58 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9838434..9839500 1..1067 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:29:57 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5725939..5727005 1..1067 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:41 Download gff for FI05704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9839633..9840699 1..1067 99   Minus

FI05704.pep Sequence

Translation from 87 to 857

> FI05704.pep
MESRDRKTSNEDDSSEISELDVGSDRFNPLRALYEPNFRVTDAVPKVIYQ
NLAAFESALKKFGIWQLNKRQKPGSAEGGDQGTSKKASTSEAVDILPPER
RFEPHQMPTTSSRKKHHRNIFTYMEAAVGPLELLTKCISPASHNESNERR
RVRVVIRKHGSVGGSVEGELLAFDKQWNLLLRNVTETWKRRKYNYGEQNI
CDTPVDCTGRLKELGITLPRTVVKNLNRKNVEIRRELPQILIRGENVVLV
SLIPTK*

FI05704.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11077-PA 251 GF11077-PA 26..250 19..231 753 62.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25258-PA 261 GG25258-PA 4..257 1..254 1167 85.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21330-PA 251 GH21330-PA 4..246 8..253 653 52.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Lsm11-PA 256 CG12924-PA 1..256 1..256 1326 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20746-PA 254 GI20746-PA 4..249 8..253 682 54.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20027-PA 262 GL20027-PA 13..261 9..253 863 65.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11912-PA 262 GA11912-PA 13..261 9..253 858 65.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20576-PA 256 GM20576-PA 1..256 1..256 1231 93.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10049-PA 256 GD10049-PA 1..256 1..256 1243 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20483-PA 251 GJ20483-PA 4..246 8..253 682 54.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20966-PA 253 GK20966-PA 19..248 19..253 675 55.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22028-PA 261 GE22028-PA 5..257 2..254 1154 87.4 Plus

FI05704.hyp Sequence

Translation from 87 to 857

> FI05704.hyp
MESRDRKTSNEDDSSEISELDVGSDRFNPLRALYEPNFRVTDAVPKVIYQ
NLAAFESALKKFGIWQLNKRQKPGSAEGGDQGTSKKASTSEAVDILPPER
RFEPHQMPTTSSRKKHHRNIFTYMEAAVGPLELLTKCISPASHNESNERR
RVRVVIRKHGSVGGSVEGELLAFDKQWNLLLRNVTETWKRRKYNYGEQNI
CDTPVDCTGRLKELGITLPRTVVKNLNRKNVEIRRELPQILIRGENVVLV
SLIPTK*

FI05704.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Lsm11-PA 256 CG12924-PA 1..256 1..256 1326 100 Plus