Clone FI06421 Report

Search the DGRC for FI06421

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:21
Vector:pOT2
Associated Gene/TranscriptMtnC-RA
Protein status:FI06421.pep: gold
Sequenced Size:260

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
MtnC 2008-08-15 Release 5.9 accounting
MtnC 2008-12-18 5.12 accounting

Clone Sequence Records

FI06421.complete Sequence

260 bp assembled on 2008-07-29

GenBank Submission: BT044268.1

> FI06421.complete
CTTTTCCAAGACCAATCAAAACACAAAAAACGATCAAAATGGTTTGCAAA
GGCTGCGGAACAAACTGCAAGTGCCAGGACACCAAGTGCGGCGACAATTG
CGCCTGTAATCAGGACTGCAAGTGCGTGTGCAAGAATGGCCCCAAAGATC
AGTGTTGCAAGAGCAAGTAGTTTAAGCCGATCGATTCGATGAAAACCAAT
AAATGATAGCCCCTGTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

FI06421.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
MtnC-RA 713 MtnC-RA 231..450 1..220 1085 99.5 Plus
MtnB-RA 584 MtnB-RA 213..337 35..159 280 81.6 Plus
MtnD.b 590 MtnD.b 89..212 35..158 200 77.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16184383..16184537 64..218 775 100 Plus
chr3R 27901430 chr3R 16184261..16184323 1..63 300 98.4 Plus
chr3R 27901430 chr3R 16327283..16327358 159..84 200 84.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20360430..20360586 64..220 785 100 Plus
3R 32079331 3R 20360308..20360370 1..63 300 98.4 Plus
3R 32079331 3R 20503349..20503424 159..84 200 84.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20101261..20101417 64..220 785 100 Plus
3R 31820162 3R 20101139..20101201 1..63 300 98.4 Plus
3R 31820162 3R 20244180..20244255 159..84 200 84.2 Minus
Blast to na_te.dros performed on 2019-03-16 18:39:31 has no hits.

FI06421.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:40:30 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16184261..16184323 1..63 98 -> Plus
chr3R 16184383..16184537 64..218 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:52 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..132 39..170 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:30 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..132 39..170 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:59 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..132 39..170 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:33 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..132 39..170 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:45:26 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..132 39..170 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:43 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..132 39..170 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:30 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..218 1..218 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:59 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..218 1..218 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:20:12 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..132 39..170 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:45:26 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 1..218 1..218 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:30 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20360308..20360370 1..63 98 -> Plus
3R 20360430..20360584 64..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:30 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20360308..20360370 1..63 98 -> Plus
3R 20360430..20360584 64..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:30 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20360308..20360370 1..63 98 -> Plus
3R 20360430..20360584 64..218 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:59 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16186030..16186092 1..63 98 -> Plus
arm_3R 16186152..16186306 64..218 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:48 Download gff for FI06421.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20101139..20101201 1..63 98 -> Plus
3R 20101261..20101415 64..218 100   Plus

FI06421.hyp Sequence

Translation from 1 to 191

> FI06421.hyp
LFQDQSKHNKRSKWFAKAAEQTASARTPSAATIAPVIRTASACARMAPKI
SVARASSLSRSIR*
Sequence FI06421.hyp has no blast hits.

FI06421.pep Sequence

Translation from 2 to 169

> FI06421.pep
FPRPIKTQKTIKMVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQ
CCKSK*

FI06421.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23027-PA 43 GF23027-PA 1..43 13..55 184 90.7 Plus
Dana\GF23030-PA 45 GF23030-PA 1..43 13..55 147 72.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\MtnC-PA 43 GG23900-PA 1..43 13..55 193 95.3 Plus
Dere\MtnB-PA 43 GG15446-PA 1..43 13..55 166 81.4 Plus
Dere\MtnD-PA 46 GG23934-PA 1..43 13..55 147 72.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14155-PA 44 GH14155-PA 1..43 13..55 154 74.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
MtnC-PA 43 CG5097-PA 1..43 13..55 273 100 Plus
MtnB-PC 43 CG4312-PC 1..43 13..55 234 81.4 Plus
MtnB-PB 43 CG4312-PB 1..43 13..55 234 81.4 Plus
MtnB-PA 43 CG4312-PA 1..43 13..55 234 81.4 Plus
MtnD-PB 44 CG33192-PB 1..43 13..55 210 72.1 Plus
MtnE-PA 41 CG42872-PA 1..41 13..55 146 55.8 Plus
MtnE-PB 41 CG42872-PB 1..41 13..55 146 55.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22231-PA 45 GI22231-PA 1..43 13..55 169 81.4 Plus
Dmoj\GI22235-PA 44 GI22235-PA 1..43 13..55 128 65.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23465-PA 45 GL23465-PA 1..43 13..55 164 79.1 Plus
Dper\GL24090-PA 43 GL24090-PA 1..43 13..55 150 72.1 Plus
Dper\GL23469-PA 44 GL23469-PA 1..43 13..55 148 72.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\MtnC-PA 45 GA27265-PA 1..43 13..55 167 81.4 Plus
Dpse\MtnB-PA 43 GA26502-PA 1..43 13..55 149 72.1 Plus
Dpse\MtnD-PA 44 GA27268-PA 1..43 13..55 148 72.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\MtnC-PA 43 GM23109-PA 1..43 13..55 198 100 Plus
Dsec\MtnB-PA 43 GM23190-PA 1..43 13..55 166 81.4 Plus
Dsec\MtnD-PA 44 GM23116-PA 1..43 13..55 146 72.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\MtnC-PA 43 GD15139-PA 1..43 13..55 198 100 Plus
Dsim\MtnB-PA 43 GD20063-PA 1..43 13..55 166 81.4 Plus
Dsim\MtnD-PA 44 GD19355-PA 1..43 13..55 146 72.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\MtnC-PA 47 GJ23034-PA 1..43 13..55 174 86 Plus
Dvir\MtnB-PA 43 GJ24195-PA 1..43 13..55 146 72.1 Plus
Dvir\MtnD-PA 44 GJ23040-PA 1..43 13..55 144 69.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22447-PA 45 GK22447-PA 1..43 13..55 164 79.1 Plus
Dwil\GK19117-PA 43 GK19117-PA 1..43 13..55 149 74.4 Plus
Dwil\GK22451-PA 45 GK22451-PA 1..43 13..55 147 72.1 Plus
Dwil\GK22728-PA 43 GK22728-PA 1..43 13..55 143 72.1 Plus
Dwil\GK22725-PA 43 GK22725-PA 1..43 13..55 142 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\MtnC-PA 43 GE25073-PA 1..42 13..54 163 81 Plus
Dyak\MtnB-PA 43 GE25072-PA 1..42 13..54 163 81 Plus
Dyak\MtnD-PA 46 GE25666-PA 1..43 13..55 142 69.8 Plus