Clone FI06422 Report

Search the DGRC for FI06422

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:22
Vector:pOT2
Associated Gene/TranscriptCG12929-RB
Protein status:FI06422.pep: gold
Sequenced Size:525

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12929 2008-08-15 Release 5.9 accounting
CG12929 2008-12-18 5.12 accounting

Clone Sequence Records

FI06422.complete Sequence

525 bp assembled on 2008-07-29

GenBank Submission: BT044269.1

> FI06422.complete
ACAAAATAGAATGCTGGATATCGCTGCACAACTCCTTGCCGTGGGCCTCT
TGTGGGGCGTTACCAATCCGTTTATTCGCCTCGGCAGCCAGGGAATCGAG
TCGGTTGGTGATACGGGCTCAAAGTGGCGTAACTTTGTCCAGGAGGCACG
CACAATCGGCTCCCGGTGGCGCTATTGGATACCCTTCGGTCTCAACCAGT
GCGGGAGTGCTCTGTACGTTTGGACGCTCCAGAGGGCCAGTATTACAGTG
GCGGTGCCAGTGGCCAATTCCCTGAGCTTCGCATTTACGGCAATCACCGG
ATATGCGCTGGGGGAAAAACTGCCGGGAAGAAGTAAGCTAAATGTCTAAG
TAACAACCTTGTCCACTTTGTTTACCAACTGCTCCCGCAGAAGTCATTCT
GGGCACCCTGCTCGTCTGCTGTGGCAGTATCCTGATGATATACGATAAGA
TTTTGCAGGAACAGGCCCAGCACCAGCTAAATATAACATTCCACTGAGGT
TACCCTAAAAAAAAAAAAAAAAAAA

FI06422.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-RB 587 CG12929-RB 76..584 1..509 2545 100 Plus
CG12929-RA 530 CG12929-RA 77..408 1..332 1660 100 Plus
CG12929-RA 530 CG12929-RA 409..527 391..509 595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5473611..5474091 506..26 2405 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9586113..9586596 509..26 2420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9587312..9587795 509..26 2420 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:18:58 has no hits.

FI06422.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:48 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5473611..5474090 27..506 100 <- Minus
chr2R 5474145..5474170 1..26 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:53 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 1..339 11..349 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:26 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 1..339 11..349 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:25 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 1..339 11..349 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:16 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 1..339 11..349 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:50:03 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 1..339 11..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:27:00 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 1..506 1..506 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:26 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 1..506 1..506 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:25 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 40..545 1..506 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 11:46:14 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 1..506 1..506 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:50:03 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RB 40..545 1..506 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:48 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9586116..9586595 27..506 100 <- Minus
2R 9586650..9586675 1..26 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:48 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9586116..9586595 27..506 100 <- Minus
2R 9586650..9586675 1..26 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:48 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9586116..9586595 27..506 100 <- Minus
2R 9586650..9586675 1..26 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:25 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5473621..5474100 27..506 100 <- Minus
arm_2R 5474155..5474180 1..26 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:50 Download gff for FI06422.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9587315..9587794 27..506 100 <- Minus
2R 9587849..9587874 1..26 100   Minus

FI06422.pep Sequence

Translation from 1 to 348

> FI06422.pep
QNRMLDIAAQLLAVGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEAR
TIGSRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITG
YALGEKLPGRSKLNV*

FI06422.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12494-PA 141 GF12494-PA 1..107 5..111 494 86 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25276-PA 142 GG25276-PA 1..108 4..111 534 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22861-PA 141 GH22861-PA 1..107 4..110 452 79.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-PB 112 CG12929-PB 1..112 4..115 583 100 Plus
CG12929-PA 142 CG12929-PA 1..107 4..110 560 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21240-PA 137 GI21240-PA 1..105 7..111 445 79 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17335-PA 142 GL17335-PA 1..107 4..110 500 88.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11916-PB 142 GA11916-PB 1..107 4..110 500 88.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20594-PA 142 GM20594-PA 1..108 4..111 545 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10067-PA 142 GD10067-PA 1..108 4..111 553 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20844-PA 160 GJ20844-PA 24..128 7..111 457 81 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15624-PA 175 GK15624-PA 46..150 7..111 472 84.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22214-PA 142 GE22214-PA 1..108 4..111 531 94.4 Plus

FI06422.hyp Sequence

Translation from 1 to 348

> FI06422.hyp
QNRMLDIAAQLLAVGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEAR
TIGSRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITG
YALGEKLPGRSKLNV*

FI06422.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-PB 112 CG12929-PB 1..112 4..115 583 100 Plus
CG12929-PA 142 CG12929-PA 1..107 4..110 560 100 Plus