BDGP Sequence Production Resources |
Search the DGRC for FI06422
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 64 |
Well: | 22 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12929-RB |
Protein status: | FI06422.pep: gold |
Sequenced Size: | 525 |
Gene | Date | Evidence |
---|---|---|
CG12929 | 2008-08-15 | Release 5.9 accounting |
CG12929 | 2008-12-18 | 5.12 accounting |
525 bp assembled on 2008-07-29
GenBank Submission: BT044269.1
> FI06422.complete ACAAAATAGAATGCTGGATATCGCTGCACAACTCCTTGCCGTGGGCCTCT TGTGGGGCGTTACCAATCCGTTTATTCGCCTCGGCAGCCAGGGAATCGAG TCGGTTGGTGATACGGGCTCAAAGTGGCGTAACTTTGTCCAGGAGGCACG CACAATCGGCTCCCGGTGGCGCTATTGGATACCCTTCGGTCTCAACCAGT GCGGGAGTGCTCTGTACGTTTGGACGCTCCAGAGGGCCAGTATTACAGTG GCGGTGCCAGTGGCCAATTCCCTGAGCTTCGCATTTACGGCAATCACCGG ATATGCGCTGGGGGAAAAACTGCCGGGAAGAAGTAAGCTAAATGTCTAAG TAACAACCTTGTCCACTTTGTTTACCAACTGCTCCCGCAGAAGTCATTCT GGGCACCCTGCTCGTCTGCTGTGGCAGTATCCTGATGATATACGATAAGA TTTTGCAGGAACAGGCCCAGCACCAGCTAAATATAACATTCCACTGAGGT TACCCTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 5473611..5474091 | 506..26 | 2405 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 9586113..9586596 | 509..26 | 2420 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 9587312..9587795 | 509..26 | 2420 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5473611..5474090 | 27..506 | 100 | <- | Minus |
chr2R | 5474145..5474170 | 1..26 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 1..339 | 11..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 1..339 | 11..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 1..339 | 11..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 1..339 | 11..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 1..339 | 11..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 1..506 | 1..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 1..506 | 1..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 40..545 | 1..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 1..506 | 1..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12929-RB | 40..545 | 1..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9586116..9586595 | 27..506 | 100 | <- | Minus |
2R | 9586650..9586675 | 1..26 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9586116..9586595 | 27..506 | 100 | <- | Minus |
2R | 9586650..9586675 | 1..26 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9586116..9586595 | 27..506 | 100 | <- | Minus |
2R | 9586650..9586675 | 1..26 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5473621..5474100 | 27..506 | 100 | <- | Minus |
arm_2R | 5474155..5474180 | 1..26 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9587315..9587794 | 27..506 | 100 | <- | Minus |
2R | 9587849..9587874 | 1..26 | 100 | Minus |
Translation from 1 to 348
> FI06422.pep QNRMLDIAAQLLAVGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEAR TIGSRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITG YALGEKLPGRSKLNV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12494-PA | 141 | GF12494-PA | 1..107 | 5..111 | 494 | 86 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25276-PA | 142 | GG25276-PA | 1..108 | 4..111 | 534 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22861-PA | 141 | GH22861-PA | 1..107 | 4..110 | 452 | 79.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12929-PB | 112 | CG12929-PB | 1..112 | 4..115 | 583 | 100 | Plus |
CG12929-PA | 142 | CG12929-PA | 1..107 | 4..110 | 560 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21240-PA | 137 | GI21240-PA | 1..105 | 7..111 | 445 | 79 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17335-PA | 142 | GL17335-PA | 1..107 | 4..110 | 500 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11916-PB | 142 | GA11916-PB | 1..107 | 4..110 | 500 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20594-PA | 142 | GM20594-PA | 1..108 | 4..111 | 545 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10067-PA | 142 | GD10067-PA | 1..108 | 4..111 | 553 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20844-PA | 160 | GJ20844-PA | 24..128 | 7..111 | 457 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15624-PA | 175 | GK15624-PA | 46..150 | 7..111 | 472 | 84.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22214-PA | 142 | GE22214-PA | 1..108 | 4..111 | 531 | 94.4 | Plus |
Translation from 1 to 348
> FI06422.hyp QNRMLDIAAQLLAVGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEAR TIGSRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITG YALGEKLPGRSKLNV*