Clone FI06423 Report

Search the DGRC for FI06423

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:23
Vector:pOT2
Associated Gene/TranscriptCG12929-RA
Protein status:FI06423.pep: gold
Sequenced Size:475

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12929 2008-08-15 Release 5.9 accounting
CG12929 2008-12-18 5.12 accounting

Clone Sequence Records

FI06423.complete Sequence

475 bp assembled on 2008-07-29

GenBank Submission: BT044270.1

> FI06423.complete
ACAAAATAGAATGCTGGATATCGCTGCACAACTCCTTGCCGTGGGCCTCT
TGTGGGGCGTTACCAATCCGTTTATTCGCCTCGGCAGCCAGGGAATCGAG
TCGGTTGGTGATACGGGCTCAAAGTGGCGTAACTTTGTCCAGGAGGCACG
CACAATCGGCTCCCGGTGGCGCTATTGGATACCCTTCGGTCTCAACCAGT
GCGGGAGTGCTCTGTACGTTTGGACGCTCCAGAGGGCCAGTATTACAGTG
GCGGTGCCAGTGGCCAATTCCCTGAGCTTCGCATTTACGGCAATCACCGG
ATATGCGCTGGGGGAAAAACTGCCGGGAAGAAAAGTCATTCTGGGCACCC
TGCTCGTCTGCTGTGGCAGTATCCTGATGATATACGATAAGATTTTGCAG
GAACAGGCCCAGCACCAGCTAAATATAACATTCCACTGAGGTTACCCTAA
ACCCAAAAAAAAAAAAAAAAAAAAA

FI06423.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-RA 530 CG12929-RA 77..530 1..454 2270 100 Plus
CG12929-RB 587 CG12929-RB 76..407 1..332 1660 100 Plus
CG12929-RB 587 CG12929-RB 466..587 333..454 610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5473785..5474091 332..26 1535 100 Minus
chr2R 21145070 chr2R 5473605..5473726 454..333 610 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9586290..9586596 332..26 1535 100 Minus
2R 25286936 2R 9586108..9586231 456..333 620 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9587489..9587795 332..26 1535 100 Minus
2R 25260384 2R 9587307..9587430 456..333 620 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:38:45 has no hits.

FI06423.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:39:31 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5473605..5473726 333..454 100 <- Minus
chr2R 5473785..5474090 27..332 100 <- Minus
chr2R 5474145..5474170 1..26 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:54 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:13 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:38:03 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:49 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:47:30 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 1..429 11..439 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:08 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 1..454 1..454 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:13 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 1..454 1..454 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:38:03 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 40..493 1..454 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 11:46:18 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 1..454 1..454 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:47:30 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
CG12929-RA 40..493 1..454 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:31 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9586110..9586231 333..454 100 <- Minus
2R 9586290..9586595 27..332 100 <- Minus
2R 9586650..9586675 1..26 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:31 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9586110..9586231 333..454 100 <- Minus
2R 9586290..9586595 27..332 100 <- Minus
2R 9586650..9586675 1..26 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:31 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9586110..9586231 333..454 100 <- Minus
2R 9586290..9586595 27..332 100 <- Minus
2R 9586650..9586675 1..26 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:38:03 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5473615..5473736 333..454 100 <- Minus
arm_2R 5473795..5474100 27..332 100 <- Minus
arm_2R 5474155..5474180 1..26 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:43 Download gff for FI06423.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9587489..9587794 27..332 100 <- Minus
2R 9587849..9587874 1..26 100   Minus
2R 9587309..9587430 333..454 100 <- Minus

FI06423.hyp Sequence

Translation from 1 to 438

> FI06423.hyp
QNRMLDIAAQLLAVGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEAR
TIGSRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITG
YALGEKLPGRKVILGTLLVCCGSILMIYDKILQEQAQHQLNITFH*

FI06423.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-PA 142 CG12929-PA 1..142 4..145 741 100 Plus
CG12929-PB 112 CG12929-PB 1..107 4..110 560 100 Plus

FI06423.pep Sequence

Translation from 1 to 438

> FI06423.pep
QNRMLDIAAQLLAVGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEAR
TIGSRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITG
YALGEKLPGRKVILGTLLVCCGSILMIYDKILQEQAQHQLNITFH*

FI06423.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12494-PA 141 GF12494-PA 1..141 5..145 640 84.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25276-PA 142 GG25276-PA 1..142 4..145 706 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22861-PA 141 GH22861-PA 1..140 4..145 571 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG12929-PA 142 CG12929-PA 1..142 4..145 741 100 Plus
CG12929-PB 112 CG12929-PB 1..107 4..110 560 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21240-PA 137 GI21240-PA 1..129 7..135 557 78.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17335-PA 142 GL17335-PA 1..142 4..145 627 83.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11916-PB 142 GA11916-PB 1..142 4..145 627 83.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20594-PA 142 GM20594-PA 1..142 4..145 729 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10067-PA 142 GD10067-PA 1..142 4..145 739 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20844-PA 160 GJ20844-PA 18..158 1..141 576 75.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15624-PA 175 GK15624-PA 46..173 7..134 579 84.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22214-PA 142 GE22214-PA 1..142 4..145 694 93.7 Plus