Clone FI06426 Report

Search the DGRC for FI06426

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:26
Vector:pOT2
Associated Gene/TranscriptCG31730-RA
Protein status:FI06426.pep: gold
Sequenced Size:600

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31730 2008-08-15 Release 5.9 accounting
CG31730 2008-12-18 5.12 accounting

Clone Sequence Records

FI06426.complete Sequence

600 bp assembled on 2008-07-28

GenBank Submission: BT044272.1

> FI06426.complete
TAAGTGATGACTAGCTTTCGGGAAATGCGTTTCGATGATTTGTTCAAAAT
TAATTCACTAGTTTTCGATGCTCTCACCGAGGTTTATAGCCTGACCTTTT
TTGTAAAGCATTTTTTGGAGTTTCCAGGACTCTCACAGATTGCCATAGCT
CCAGGTCCTGATGGCAGACCCATGGGATATATATTCGGGCAGTATCAGGT
CAAGCGCAACCAGGATCCCTATGGTCATGTGGCAGCATTGACTGTATCTC
CGGAGTACCGACGCCTTGGACTGGCCACTGCTCTAATGGATTTTTTCTTT
ATGGTCTCAGACCTTAAAGGAGCTTCCTATGTTAACCTCTTTATGCGAAT
CAGTAATCGGGCTGCCTATCAATTGTACACTTCTTTGGGTTATGCTCATC
GCCAAACATTCCTGGACTACTATCCGGATGAACCGAAGCCAGAAAGTGCC
TACGAATTGAGAAAGTACGTTCCCCGCCCCATGGAGGTTCAATGAGCAGT
GCAACCGCGTTGCCTTCAGATTAAATTAAAAGTTTTTTTTTGGATTACAT
AGCTAATTAAAGAAAATCCATTGAGGTGAAAAAAAAAAAAAAAAAAAAAA

FI06426.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG31730-RA 578 CG31730-RA 1..578 1..578 2890 100 Plus
CG31730.a 617 CG31730.a 85..548 1..464 2320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13257727..13258304 578..1 2890 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13259062..13259641 580..1 2900 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13259062..13259641 580..1 2900 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:31:34 has no hits.

FI06426.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:32:12 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13257727..13258304 1..578 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:52:57 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..489 7..495 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:03 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..489 7..495 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:01:12 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..489 7..495 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:09 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..489 7..495 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:27 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..489 7..495 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:18 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..578 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:03 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..578 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:01:12 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..578 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:35 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 1..578 1..578 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:27 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
CG31730-RA 103..680 1..578 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:12 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13259064..13259641 1..578 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:12 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13259064..13259641 1..578 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:32:12 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13259064..13259641 1..578 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:01:12 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13259064..13259641 1..578 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:20 Download gff for FI06426.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13259064..13259641 1..578 100   Minus

FI06426.hyp Sequence

Translation from 6 to 494

> FI06426.hyp
MTSFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPG
PDGRPMGYIFGQYQVKRNQDPYGHVAALTVSPEYRRLGLATALMDFFFMV
SDLKGASYVNLFMRISNRAAYQLYTSLGYAHRQTFLDYYPDEPKPESAYE
LRKYVPRPMEVQ*

FI06426.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG31730-PA 162 CG31730-PA 1..162 1..162 850 100 Plus
NAA20-PD 175 CG14222-PD 1..153 1..157 327 45.2 Plus
NAA20-PC 175 CG14222-PC 1..153 1..157 327 45.2 Plus
NAA20-PA 175 CG14222-PA 1..153 1..157 327 45.2 Plus
NAA20-PB 180 CG14222-PB 1..153 1..157 327 45.2 Plus

FI06426.pep Sequence

Translation from 6 to 494

> FI06426.pep
MTSFREMRFDDLFKINSLVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPG
PDGRPMGYIFGQYQVKRNQDPYGHVAALTVSPEYRRLGLATALMDFFFMV
SDLKGASYVNLFMRISNRAAYQLYTSLGYAHRQTFLDYYPDEPKPESAYE
LRKYVPRPMEVQ*

FI06426.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21684-PA 165 GF21684-PA 1..162 1..162 655 74.7 Plus
Dana\GF20277-PA 175 GF20277-PA 1..156 1..160 323 43.8 Plus
Dana\GF23106-PA 205 GF23106-PA 1..163 1..160 239 36.1 Plus
Dana\GF10586-PA 201 GF10586-PA 2..151 3..153 160 32.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10216-PA 162 GG10216-PA 1..162 1..162 762 88.3 Plus
Dere\GG18041-PA 175 GG18041-PA 1..156 1..160 326 44.4 Plus
Dere\GG23832-PA 203 GG23832-PA 1..154 1..152 211 36.2 Plus
Dere\GG15426-PA 196 GG15426-PA 2..151 3..153 157 31.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25096-PA 182 GH25096-PA 1..150 1..151 372 49.7 Plus
Dgri\GH24558-PA 175 GH24558-PA 1..153 1..157 330 46.2 Plus
Dgri\GH22808-PA 169 GH22808-PA 1..159 1..162 285 38.3 Plus
Dgri\GH16055-PA 200 GH16055-PA 2..151 3..153 156 31.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31730-PA 162 CG31730-PA 1..162 1..162 850 100 Plus
Naa20A-PD 175 CG14222-PD 1..153 1..157 327 45.2 Plus
Naa20A-PC 175 CG14222-PC 1..153 1..157 327 45.2 Plus
Naa20A-PA 175 CG14222-PA 1..153 1..157 327 45.2 Plus
Naa20A-PB 180 CG14222-PB 1..153 1..157 327 45.2 Plus
Naa20B-PB 204 CG31851-PB 1..155 1..152 228 37.3 Plus
Naa20B-PA 204 CG31851-PA 1..155 1..152 228 37.3 Plus
vnc-PB 196 CG11989-PB 9..151 10..153 155 32.4 Plus
vnc-PC 196 CG11989-PC 9..151 10..153 155 32.4 Plus
vnc-PD 196 CG11989-PD 9..151 10..153 155 32.4 Plus
vnc-PE 196 CG11989-PE 9..151 10..153 155 32.4 Plus
vnc-PA 196 CG11989-PA 9..151 10..153 155 32.4 Plus
Naa30B-PA 211 CG32319-PA 69..187 18..139 140 31.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20782-PA 183 GI20782-PA 1..151 1..153 386 49.4 Plus
Dmoj\GI16318-PA 175 GI16318-PA 1..153 1..157 327 46.2 Plus
Dmoj\GI20771-PA 204 GI20771-PA 1..156 1..152 289 40.7 Plus
Dmoj\GI12318-PA 196 GI12318-PA 2..151 3..153 162 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26694-PA 182 GL26694-PA 1..157 1..157 489 61.1 Plus
Dper\GL23518-PA 178 GL23518-PA 1..153 1..157 337 45.2 Plus
Dper\GL27103-PA 175 GL27103-PA 1..156 1..160 323 43.8 Plus
Dper\GL26319-PA 203 GL26319-PA 1..165 1..160 286 38.6 Plus
Dper\GL12574-PA 160 GL12574-PA 2..142 3..141 153 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16428-PA 182 GA16428-PA 1..157 1..157 493 61.1 Plus
Dpse\GA27286-PA 178 GA27286-PA 1..153 1..157 337 45.2 Plus
Dpse\GA22686-PA 175 GA22686-PA 1..156 1..160 323 43.8 Plus
Dpse\GA16524-PA 203 GA16524-PA 1..165 1..160 277 38 Plus
Dpse\GA11315-PA 201 GA11315-PA 2..151 3..153 159 32.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25705-PA 162 GM25705-PA 1..162 1..162 836 97.5 Plus
Dsec\GM10355-PA 204 GM10355-PA 1..163 1..160 224 34.9 Plus
Dsec\GM25199-PA 196 GM25199-PA 2..151 3..153 162 31.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22076-PA 162 GD22076-PA 1..162 1..162 839 97.5 Plus
Dsim\GD23882-PA 204 GD23882-PA 1..163 1..160 220 34.9 Plus
Dsim\GD14230-PA 196 GD14230-PA 2..151 3..153 162 31.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17963-PA 184 GJ17963-PA 1..159 1..162 405 48.8 Plus
Dvir\GJ15656-PA 175 GJ15656-PA 1..153 1..157 321 45.6 Plus
Dvir\GJ17962-PA 178 GJ17962-PA 1..164 1..160 284 38.8 Plus
Dvir\GJ13255-PA 195 GJ13255-PA 2..151 3..153 160 32.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15295-PA 227 GK15295-PA 1..157 1..162 440 53.7 Plus
Dwil\GK24995-PA 187 GK24995-PA 1..153 1..157 323 45.2 Plus
Dwil\GK19033-PA 196 GK19033-PA 1..148 1..152 275 37.7 Plus
Dwil\GK17457-PA 201 GK17457-PA 2..151 3..153 156 32.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11776-PA 157 GE11776-PA 1..157 1..162 724 85.8 Plus
Dyak\GE17370-PA 175 GE17370-PA 1..156 1..160 326 44.4 Plus
Dyak\GE18637-PA 204 GE18637-PA 1..163 1..160 218 36.1 Plus
Dyak\GE21734-PA 196 GE21734-PA 2..151 3..153 157 31.6 Plus