FI06428.complete Sequence
685 bp assembled on 2008-07-29
GenBank Submission: BT044273.1
> FI06428.complete
CGTTGAAGAAATGCGTACTTTGTGTGCTCTAAGTTTGATCGCTTTTATGG
GCATAACCCTAATATCTACAAAGCCATTAGATGAATCTATCAAACCGAAA
GTTTTAAGGCCACTAAATCAAGCGGATTTGGATAAAATGATAAAAAACTT
GCAGTTGCTTGAAAAATTAGCCAATGAGACATATTATTCACCAGATCCCA
CCAAAAAGGAGACATACTTAACGCAAGATCAAAAGGCGGAGGAAACTAAA
GAGCCAACTGGAGAGGAAACCGAGGAACCTTCTGGAGAGGAAACTCACAG
TCCTACGGGAGAGGAAACCAAAAGTCAAACTGGAGAAGATGGCGAGTTCT
TCGAAGATGAAGAGGAGGAAGATGAAGCGACTGTGGATAAACCAACTGAT
GTCATACCAGTTAATTTTCTAAAATATCCCGAGCACGAAGCTGATTTTAA
GTCTTATCCAAGGTTTGCAATCCTTCGAAATGGCTATGTGCATCACATGA
ACTTGGACTTTTAGCGTTTACGCAATTTCATCACAAATTCGAGCTAATGA
CGTGTTCTCAAGAACATTGTCAGTTAATGTCGATAGATGGGGAAATTCCG
ACTACAGTCAGGTGGTTTGCACAGCTGTGACTCTGAATAAAAGTTAGATC
TGTGGTACCTAAAAAAAAAAAAAAAAAAAAAAAAA
FI06428.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:05:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18581-RA | 504 | CG18581-RA | 1..504 | 11..514 | 2520 | 100 | Plus |
nc_12651.a | 484 | nc_12651.a | 230..484 | 191..445 | 1275 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:53:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 15039593..15040252 | 660..1 | 3255 | 99.5 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:53:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15049549..15050209 | 661..1 | 3305 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 15042649..15043309 | 661..1 | 3305 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 12:53:36 has no hits.
FI06428.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:54:40 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 15039593..15040252 | 1..660 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:00 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..504 | 11..514 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:25 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..504 | 11..514 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:52:19 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..504 | 11..514 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:52 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..504 | 11..514 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:14:15 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..504 | 11..514 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:25 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..504 | 11..514 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:25 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..660 | 1..660 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:52:19 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..660 | 1..660 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:45 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..504 | 11..514 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:14:15 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18581-RA | 1..660 | 1..660 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:40 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15049550..15050209 | 1..660 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:40 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15049550..15050209 | 1..660 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:40 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15049550..15050209 | 1..660 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:52:19 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15042650..15043309 | 1..660 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:57 Download gff for
FI06428.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15042650..15043309 | 1..660 | 100 | | Minus |
FI06428.hyp Sequence
Translation from 1 to 513
> FI06428.hyp
VEEMRTLCALSLIAFMGITLISTKPLDESIKPKVLRPLNQADLDKMIKNL
QLLEKLANETYYSPDPTKKETYLTQDQKAEETKEPTGEETEEPSGEETHS
PTGEETKSQTGEDGEFFEDEEEEDEATVDKPTDVIPVNFLKYPEHEADFK
SYPRFAILRNGYVHHMNLDF*
FI06428.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18581-PA | 167 | CG18581-PA | 1..167 | 4..170 | 875 | 100 | Plus |
FI06428.pep Sequence
Translation from 1 to 513
> FI06428.pep
VEEMRTLCALSLIAFMGITLISTKPLDESIKPKVLRPLNQADLDKMIKNL
QLLEKLANETYYSPDPTKKETYLTQDQKAEETKEPTGEETEEPSGEETHS
PTGEETKSQTGEDGEFFEDEEEEDEATVDKPTDVIPVNFLKYPEHEADFK
SYPRFAILRNGYVHHMNLDF*
FI06428.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:32:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20129-PA | 165 | GF20129-PA | 1..165 | 4..170 | 326 | 46.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:32:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13693-PA | 160 | GG13693-PA | 1..160 | 4..170 | 474 | 61.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18581-PA | 167 | CG18581-PA | 1..167 | 4..170 | 875 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:32:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25888-PA | 132 | GL25888-PA | 1..132 | 4..170 | 251 | 39.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:32:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA14999-PA | 127 | GA14999-PA | 1..127 | 4..170 | 264 | 40.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:32:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24513-PA | 157 | GM24513-PA | 1..157 | 4..170 | 560 | 84.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:32:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12584-PA | 157 | GD12584-PA | 1..157 | 4..170 | 623 | 83.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:32:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19987-PA | 163 | GE19987-PA | 1..163 | 4..170 | 563 | 73.1 | Plus |