Clone FI06428 Report

Search the DGRC for FI06428

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:28
Vector:pOT2
Associated Gene/TranscriptCG18581-RA
Protein status:FI06428.pep: gold
Sequenced Size:685

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18581 2008-08-15 Release 5.9 accounting
CG18581 2008-12-18 5.12 accounting

Clone Sequence Records

FI06428.complete Sequence

685 bp assembled on 2008-07-29

GenBank Submission: BT044273.1

> FI06428.complete
CGTTGAAGAAATGCGTACTTTGTGTGCTCTAAGTTTGATCGCTTTTATGG
GCATAACCCTAATATCTACAAAGCCATTAGATGAATCTATCAAACCGAAA
GTTTTAAGGCCACTAAATCAAGCGGATTTGGATAAAATGATAAAAAACTT
GCAGTTGCTTGAAAAATTAGCCAATGAGACATATTATTCACCAGATCCCA
CCAAAAAGGAGACATACTTAACGCAAGATCAAAAGGCGGAGGAAACTAAA
GAGCCAACTGGAGAGGAAACCGAGGAACCTTCTGGAGAGGAAACTCACAG
TCCTACGGGAGAGGAAACCAAAAGTCAAACTGGAGAAGATGGCGAGTTCT
TCGAAGATGAAGAGGAGGAAGATGAAGCGACTGTGGATAAACCAACTGAT
GTCATACCAGTTAATTTTCTAAAATATCCCGAGCACGAAGCTGATTTTAA
GTCTTATCCAAGGTTTGCAATCCTTCGAAATGGCTATGTGCATCACATGA
ACTTGGACTTTTAGCGTTTACGCAATTTCATCACAAATTCGAGCTAATGA
CGTGTTCTCAAGAACATTGTCAGTTAATGTCGATAGATGGGGAAATTCCG
ACTACAGTCAGGTGGTTTGCACAGCTGTGACTCTGAATAAAAGTTAGATC
TGTGGTACCTAAAAAAAAAAAAAAAAAAAAAAAAA

FI06428.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG18581-RA 504 CG18581-RA 1..504 11..514 2520 100 Plus
nc_12651.a 484 nc_12651.a 230..484 191..445 1275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15039593..15040252 660..1 3255 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15049549..15050209 661..1 3305 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15042649..15043309 661..1 3305 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:53:36 has no hits.

FI06428.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:54:40 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15039593..15040252 1..660 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:00 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..504 11..514 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:25 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..504 11..514 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:52:19 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..504 11..514 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:52 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..504 11..514 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:14:15 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..504 11..514 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:25 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..504 11..514 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:25 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:52:19 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..660 1..660 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:45 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..504 11..514 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:14:15 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
CG18581-RA 1..660 1..660 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:40 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15049550..15050209 1..660 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:40 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15049550..15050209 1..660 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:54:40 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15049550..15050209 1..660 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:52:19 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15042650..15043309 1..660 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:57 Download gff for FI06428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15042650..15043309 1..660 100   Minus

FI06428.hyp Sequence

Translation from 1 to 513

> FI06428.hyp
VEEMRTLCALSLIAFMGITLISTKPLDESIKPKVLRPLNQADLDKMIKNL
QLLEKLANETYYSPDPTKKETYLTQDQKAEETKEPTGEETEEPSGEETHS
PTGEETKSQTGEDGEFFEDEEEEDEATVDKPTDVIPVNFLKYPEHEADFK
SYPRFAILRNGYVHHMNLDF*

FI06428.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG18581-PA 167 CG18581-PA 1..167 4..170 875 100 Plus

FI06428.pep Sequence

Translation from 1 to 513

> FI06428.pep
VEEMRTLCALSLIAFMGITLISTKPLDESIKPKVLRPLNQADLDKMIKNL
QLLEKLANETYYSPDPTKKETYLTQDQKAEETKEPTGEETEEPSGEETHS
PTGEETKSQTGEDGEFFEDEEEEDEATVDKPTDVIPVNFLKYPEHEADFK
SYPRFAILRNGYVHHMNLDF*

FI06428.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20129-PA 165 GF20129-PA 1..165 4..170 326 46.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13693-PA 160 GG13693-PA 1..160 4..170 474 61.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG18581-PA 167 CG18581-PA 1..167 4..170 875 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25888-PA 132 GL25888-PA 1..132 4..170 251 39.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14999-PA 127 GA14999-PA 1..127 4..170 264 40.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24513-PA 157 GM24513-PA 1..157 4..170 560 84.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12584-PA 157 GD12584-PA 1..157 4..170 623 83.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19987-PA 163 GE19987-PA 1..163 4..170 563 73.1 Plus