Clone FI06429 Report

Search the DGRC for FI06429

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:29
Vector:pOT2
Associated Gene/TranscriptCG31041-RA
Protein status:FI06429.pep: gold
Sequenced Size:720

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31041 2008-08-15 Release 5.9 accounting
CG31041 2008-12-18 5.12 accounting

Clone Sequence Records

FI06429.complete Sequence

720 bp assembled on 2008-07-28

GenBank Submission: BT044274.1

> FI06429.complete
CTCCAAGTGTCGAAAGTGAATATGTCGTTCAAGGCCGTCCCCCTTTTGTT
GGCTATCGGCGCCGTCTTCGTGGCTGCCGTGCCCACTCCCGTCGAGACCG
AGAGGGAGTCCTCGCTGGTGGAGCTCCTGCTCAGTTCTCCGGCCATGCGA
TCGGATCTCTTCAACGTCGAATGCGTGGACTACTACAGCCCGCTCCTTAA
GGGTCACGTGGACAAGTACAACGAGGACTTCACCGCGTGCAAGGACAATT
ACGACGGGGCCTTCTCCCTGATCGACTCAAGCTACCGCAGTTCCCGCGAC
GAGCTGTCCGTATCCGTGAGGGACACCTGCCTTTCCCTCCTGACCTGCAA
TGGCAGGACCTCGAACTCCGATGCCTTCGAGTGCTTGGCCTCTGGGGGTC
CTTCGGCATCCAAGGAACTGGAGAAAGCTTCCTACAACGCATCCGACAAC
CAAACCAGCCTGCTCGCCGAGGTGTCCGTAATCTCGGAAACGCTATCCAG
ATGCCAAATCGAAGCCTACCGGACCTACAACACCAACCACGGCGAGTGCT
ACGCCGACATGGTAGCCTGCCTGGGTGATCCCAACTGGGAGTTTCCCAGC
ACGAACTACGTGCTCTAGGACTCGAGTCAAGATTCAGATCACCTCGAGCA
CCCTGTATTCGTGAACTTTTATCGCTGTAAATAAAAGACTTTGAGTGAAA
AAAAAAAAAAAAAAAAAAAA

FI06429.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG31041-RA 1025 CG31041-RA 206..904 1..699 3495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25413081..25413477 397..1 1970 99.7 Minus
chr3R 27901430 chr3R 25412644..25412945 697..396 1465 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29590507..29590903 397..1 1985 100 Minus
3R 32079331 3R 29590068..29590371 699..396 1520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29331338..29331734 397..1 1985 100 Minus
3R 31820162 3R 29330899..29331202 699..396 1520 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:43:54 has no hits.

FI06429.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:44:32 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25412644..25412944 397..697 99 <- Minus
chr3R 25413082..25413477 1..396 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:02 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 1..597 22..618 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:08 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 1..597 22..618 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:32:43 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 1..597 22..618 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:11 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 1..597 22..618 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:41:45 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 1..597 22..618 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:24 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 1..688 10..697 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:08 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 4..700 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:32:43 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 4..700 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:37 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 1..688 10..697 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:41:45 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 4..700 1..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:32 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29590070..29590370 397..697 100 <- Minus
3R 29590508..29590903 1..396 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:32 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29590070..29590370 397..697 100 <- Minus
3R 29590508..29590903 1..396 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:32 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29590070..29590370 397..697 100 <- Minus
3R 29590508..29590903 1..396 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:32:43 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25415792..25416092 397..697 100 <- Minus
arm_3R 25416230..25416625 1..396 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:26 Download gff for FI06429.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29330901..29331201 397..697 100 <- Minus
3R 29331339..29331734 1..396 100   Minus

FI06429.hyp Sequence

Translation from 0 to 617

> FI06429.hyp
LQVSKVNMSFKAVPLLLAIGAVFVAAVPTPVETERESSLVELLLSSPAMR
SDLFNVECVDYYSPLLKGHVDKYNEDFTACKDNYDGAFSLIDSSYRSSRD
ELSVSVRDTCLSLLTCNGRTSNSDAFECLASGGPSASKELEKASYNASDN
QTSLLAEVSVISETLSRCQIEAYRTYNTNHGECYADMVACLGDPNWEFPS
TNYVL*

FI06429.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG31041-PA 198 CG31041-PA 1..198 8..205 1024 100 Plus
CG10912-PA 271 CG10912-PA 1..189 8..195 236 28.4 Plus
CG10911-PA 359 CG10911-PA 1..185 8..191 230 29.2 Plus
CG7567-PA 211 CG7567-PA 50..193 48..191 148 25 Plus

FI06429.pep Sequence

Translation from 0 to 617

> FI06429.pep
LQVSKVNMSFKAVPLLLAIGAVFVAAVPTPVETERESSLVELLLSSPAMR
SDLFNVECVDYYSPLLKGHVDKYNEDFTACKDNYDGAFSLIDSSYRSSRD
ELSVSVRDTCLSLLTCNGRTSNSDAFECLASGGPSASKELEKASYNASDN
QTSLLAEVSVISETLSRCQIEAYRTYNTNHGECYADMVACLGDPNWEFPS
TNYVL*

FI06429.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22880-PA 200 GF22880-PA 1..196 8..201 383 40.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12012-PA 198 GG12012-PA 1..198 8..205 880 82.8 Plus
Dere\GG20996-PA 284 GG20996-PA 1..186 8..192 230 31 Plus
Dere\GG20997-PA 383 GG20997-PA 31..189 38..194 193 30.8 Plus
Dere\GG12014-PA 210 GG12014-PA 50..206 48..196 147 27.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20448-PA 278 GH20448-PA 1..181 8..190 145 24.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31041-PA 198 CG31041-PA 1..198 8..205 1024 100 Plus
CG10912-PA 271 CG10912-PA 1..189 8..195 236 28.4 Plus
CG10911-PA 359 CG10911-PA 1..185 8..191 230 29.2 Plus
CG7567-PA 211 CG7567-PA 50..193 48..191 148 25 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24460-PA 223 GI24460-PA 1..192 8..195 197 30.7 Plus
Dmoj\GI19276-PA 375 GI19276-PA 13..176 30..191 148 25 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13585-PA 197 GL13585-PA 28..193 37..201 322 36.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15961-PA 197 GA15961-PA 28..193 37..201 322 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12237-PA 157 GM12237-PA 1..157 49..205 767 91.1 Plus
Dsec\GM19931-PA 366 GM19931-PA 1..189 8..194 190 28.6 Plus
Dsec\GM19930-PA 246 GM19930-PA 1..186 8..192 173 26.2 Plus
Dsec\GM12239-PA 211 GM12239-PA 60..206 58..203 158 26.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17724-PA 198 GD17724-PA 1..198 8..205 946 94.4 Plus
Dsim\GD25419-PA 287 GD25419-PA 1..190 8..199 202 28.4 Plus
Dsim\GD25420-PA 381 GD25420-PA 1..189 8..194 180 27.5 Plus
Dsim\GD17731-PA 199 GD17731-PA 38..194 48..203 155 26.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10549-PA 211 GJ10549-PA 1..188 8..193 247 34.2 Plus
Dvir\GJ10550-PA 211 GJ10550-PA 1..195 8..202 245 33.3 Plus
Dvir\GJ22154-PA 332 GJ22154-PA 24..181 36..191 149 25.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11180-PA 229 GK11180-PA 19..207 12..202 200 29.5 Plus
Dwil\GK17899-PA 237 GK17899-PA 61..214 58..204 186 29.9 Plus
Dwil\GK10323-PA 189 GK10323-PA 1..187 8..193 177 27.4 Plus
Dwil\GK22059-PA 340 GK22059-PA 7..178 13..191 164 29.5 Plus
Dwil\GK10322-PA 198 GK10322-PA 4..188 11..193 155 25.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10448-PA 198 GE10448-PA 1..198 8..205 796 76.8 Plus
Dyak\GE13940-PA 406 GE13940-PA 1..186 8..192 224 29.9 Plus
Dyak\GE13939-PA 272 GE13939-PA 1..185 8..191 179 25.8 Plus
Dyak\GE10450-PA 211 GE10450-PA 51..195 48..192 145 22.8 Plus