Clone FI06430 Report

Search the DGRC for FI06430

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:30
Vector:pOT2
Associated Gene/TranscriptCG32712-RB
Protein status:FI06430.pep: gold
Sequenced Size:619

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32712 2008-08-15 Release 5.9 accounting
CG32712 2008-12-18 5.12 accounting

Clone Sequence Records

FI06430.complete Sequence

619 bp assembled on 2008-07-29

GenBank Submission: BT044275.1

> FI06430.complete
ACTCGGTGGAGCACAATGTGGAAGAGCCTGGGACTCGGTTGCGGTCTACT
TTCTCTTGGCGCCTTCATCTCCTGCTTTGTGGCGCTGCACATGCTCAACC
AGATTATTCACATCGAACTGGACGCCTCCGTTGACGTGACCATGCAATTG
GAGGCCGACAAAGATTTGGACGTACGCTGCCATGGCACCCTGATCGTTGG
CAATCCGGATGCAGCGCATCTTAGCCGGCAGGAGTTATCGTATTTGCGCT
GGACGGTGGTGTTCACGCTGCTCTACTCCTTCGCGACCACGCTCCTCATC
CGGGCCAAGTACTTGGGCAATTTTGAGATTAGCCTGGCCACCTCCAATGC
GATGATGCTGATGGGATCCCTGCTATCGGTGCTTCTGGTTATGGTCACCG
TTGCTCTCCATCAGCATGAACCATTCCCGGATCTGCGGTGCAACCAGTTG
GTTGTCTACCACTTGTACTACATCGCCCTGAACACCGCCATCTCAGTGGT
GTTCTTCCTGGTCCATTCCATTCAGGAGCTGCTGCTGCATCGTTTACAGC
CGACATTGAAGTACTAAGTACCGAACCTCCATAATCAAGGTTTTAAGAAC
AAAAAAAAAAAAAAAAAAA

FI06430.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG32712-RB 696 CG32712-RB 40..653 1..614 3070 100 Plus
CG32712.a 2588 CG32712.a 30..643 1..614 3070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8325132..8325416 351..67 1425 100 Minus
chrX 22417052 chrX 8324831..8325079 599..351 1200 98.8 Minus
chrX 22417052 chrX 8325487..8325552 66..1 330 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8433389..8433673 351..67 1425 100 Minus
X 23542271 X 8433073..8433336 614..351 1320 100 Minus
X 23542271 X 8433744..8433809 66..1 330 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8441487..8441771 351..67 1425 100 Minus
X 23527363 X 8441171..8441434 614..351 1320 100 Minus
X 23527363 X 8441842..8441907 66..1 330 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:55:35 has no hits.

FI06430.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:56:14 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8324830..8325078 352..600 98 <- Minus
chrX 8325132..8325416 67..351 100 <- Minus
chrX 8325487..8325552 1..66 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:03 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 1..552 16..567 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:27 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 1..552 16..567 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:57:45 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 1..552 16..567 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:17 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RA 1..477 91..567 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:49:29 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 1..552 16..567 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:27:02 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:27 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:57:45 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 11:52:55 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RA 1..477 91..567 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:49:29 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 1..600 1..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:14 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
X 8433087..8433335 352..600 100 <- Minus
X 8433389..8433673 67..351 100 <- Minus
X 8433744..8433809 1..66 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:14 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
X 8433087..8433335 352..600 100 <- Minus
X 8433389..8433673 67..351 100 <- Minus
X 8433744..8433809 1..66 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:14 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
X 8433087..8433335 352..600 100 <- Minus
X 8433389..8433673 67..351 100 <- Minus
X 8433744..8433809 1..66 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:57:45 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8327120..8327368 352..600 100 <- Minus
arm_X 8327422..8327706 67..351 100 <- Minus
arm_X 8327777..8327842 1..66 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:52 Download gff for FI06430.complete
Subject Subject Range Query Range Percent Splice Strand
X 8441185..8441433 352..600 100 <- Minus
X 8441487..8441771 67..351 100 <- Minus
X 8441842..8441907 1..66 100   Minus

FI06430.hyp Sequence

Translation from 0 to 566

> FI06430.hyp
TRWSTMWKSLGLGCGLLSLGAFISCFVALHMLNQIIHIELDASVDVTMQL
EADKDLDVRCHGTLIVGNPDAAHLSRQELSYLRWTVVFTLLYSFATTLLI
RAKYLGNFEISLATSNAMMLMGSLLSVLLVMVTVALHQHEPFPDLRCNQL
VVYHLYYIALNTAISVVFFLVHSIQELLLHRLQPTLKY*

FI06430.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32712-PB 183 CG32712-PB 1..183 6..188 933 100 Plus

FI06430.pep Sequence

Translation from 0 to 566

> FI06430.pep
TRWSTMWKSLGLGCGLLSLGAFISCFVALHMLNQIIHIELDASVDVTMQL
EADKDLDVRCHGTLIVGNPDAAHLSRQELSYLRWTVVFTLLYSFATTLLI
RAKYLGNFEISLATSNAMMLMGSLLSVLLVMVTVALHQHEPFPDLRCNQL
VVYHLYYIALNTAISVVFFLVHSIQELLLHRLQPTLKY*

FI06430.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21839-PA 199 GF21839-PA 14..189 1..183 453 52.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24200-PA 180 GH24200-PA 1..170 6..175 422 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG32712-PB 183 CG32712-PB 1..183 6..188 933 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15884-PA 181 GI15884-PA 1..171 6..175 387 44.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16568-PA 429 GL16568-PA 275..412 36..173 332 45.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23105-PA 185 GA23105-PA 18..168 23..173 381 47.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21388-PA 183 GM21388-PA 1..183 6..188 874 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24571-PA 183 GD24571-PA 1..183 6..188 856 90.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18711-PA 178 GJ18711-PA 1..168 6..175 410 46.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24930-PA 181 GK24930-PA 1..170 6..175 387 45.1 Plus