Clone FI06431 Report

Search the DGRC for FI06431

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:31
Vector:pOT2
Associated Gene/TranscriptCG32847-RB
Protein status:FI06431.pep: gold
Sequenced Size:746

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32847 2008-08-15 Release 5.9 accounting
CG32847 2008-12-18 5.12 accounting

Clone Sequence Records

FI06431.complete Sequence

746 bp assembled on 2008-07-29

GenBank Submission: BT044276.1

> FI06431.complete
ATTAGACTTAAACAAAATTACCTGCGCTAGAAACACACACATCGGAAACA
ATGTCGGCTGATACTTTCGTAATGGACACCAAGGATGAATCGTTCTACGA
GTGTAACATATGTCTAGACACCGCCCAGAATGCCGTGGTCAGCATGTGTG
GCCATTTGTTTTGCTGGCCATGTCTGTACCAATGGATATTGACGAAACCC
GATCACACAGTGTGTCCCGTTTGCAAGTCGGGCGTGGATAGGAGCAAAGT
AATACCGGTGTACGCACGAAATGATAAAAGGCAGGAGGATCCGCGGGATA
AAACACCGCCGCGTCCAACTGGAATTTGGTCGGATTACGCAAATGATCTC
GAGTTGGGACTATTTTCGTACTTGCTTTTTGGTTTATTCTTTCCATATGG
TGCCCTATCATCTTATCTGGATATGGACGAGCCACTCAATCCTGCTGCTG
ATCACGGCATAAGGGATGGGCAGAACGAAACACTCCTTTCTAAGTTCTTT
CTCTACGTGGCCATTATGCTCATTATTTATATGATTGTAATTTAGCAAGA
ATAGGAATAAGATCAAAATAAACCATGATGGTGCAAATGAATCAGTATAA
CCGGGAAGATGTCGTCCTTTACAAATTATGTTCAGTGAAGTTTTCGGATA
ATTAGTCATTAATCTTTTTAGTATTGTGTAGCATTATGTAAAACAAATGT
AATGAAAAGTAAATATTCAAATGCACTAGGAAAAAAAAAAAAAAAA

FI06431.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG32847-RB 495 CG32847-RB 1..495 51..545 2475 100 Plus
CG8974-RD 1314 CG8974-RD 454..632 94..272 310 78.2 Plus
CG8974-RE 1340 CG8974-RE 489..667 94..272 310 78.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15111644..15112370 1..727 3560 99.3 Plus
chrX 22417052 chrX 15684379..15684557 272..94 310 78.2 Minus
chrX 22417052 chrX 15687549..15687727 272..94 310 78.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15121572..15122309 1..738 3675 99.9 Plus
X 23542271 X 15794520..15794698 272..94 310 78.2 Minus
X 23542271 X 15797690..15797868 272..94 310 78.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15114672..15115409 1..738 3675 99.8 Plus
X 23527363 X 15805788..15805966 272..94 310 78.2 Minus
X 23527363 X 15802618..15802796 272..94 310 78.2 Minus
Blast to na_te.dros performed on 2019-03-15 15:13:10 has no hits.

FI06431.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:14:03 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15111644..15112372 1..730 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:05 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..495 51..545 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:12 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..495 51..545 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:07:39 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..495 51..545 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:48 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..495 51..545 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:45 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..495 51..545 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:06 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..495 51..545 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:12 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..730 1..730 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:07:39 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..730 1..730 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 11:46:23 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..495 51..545 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:45 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 1..730 1..730 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:14:03 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15121572..15122301 1..730 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:14:03 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15121572..15122301 1..730 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:14:03 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15121572..15122301 1..730 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:07:39 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15114672..15115401 1..730 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:41 Download gff for FI06431.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15114672..15115401 1..730 100   Plus

FI06431.pep Sequence

Translation from 50 to 544

> FI06431.pep
MSADTFVMDTKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKP
DHTVCPVCKSGVDRSKVIPVYARNDKRQEDPRDKTPPRPTGIWSDYANDL
ELGLFSYLLFGLFFPYGALSSYLDMDEPLNPAADHGIRDGQNETLLSKFF
LYVAIMLIIYMIVI*

FI06431.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19745-PA 252 GF19745-PA 87..250 9..162 392 47 Plus
Dana\GF19854-PA 189 GF19854-PA 113..183 12..82 309 70.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19371-PA 277 GG19371-PA 111..274 4..161 436 48.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12208-PA 273 GH12208-PA 115..271 12..162 436 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32847-PB 164 CG32847-PB 1..164 1..164 897 100 Plus
CG8974-PE 277 CG8974-PE 117..274 10..161 438 51.3 Plus
CG8974-PD 277 CG8974-PD 117..274 10..161 438 51.3 Plus
CG8974-PB 277 CG8974-PB 117..274 10..161 438 51.3 Plus
CG8974-PA 277 CG8974-PA 117..274 10..161 438 51.3 Plus
CG8974-PC 277 CG8974-PC 117..274 10..161 438 51.3 Plus
CG32581-PB 283 CG32581-PB 117..275 10..163 389 47.5 Plus
CG32581-PA 283 CG32581-PA 117..275 10..163 389 47.5 Plus
CG34308-PC 194 CG34308-PC 25..92 9..76 145 35.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15740-PA 285 GI15740-PA 124..283 9..162 435 50 Plus
Dmoj\GI13710-PA 151 GI13710-PA 1..133 8..127 223 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22918-PA 241 GL22918-PA 80..239 9..162 450 51.9 Plus
Dper\GL22919-PA 280 GL22919-PA 122..278 12..162 448 52.2 Plus
Dper\GL14111-PA 280 GL14111-PA 122..278 12..162 448 52.2 Plus
Dper\GL14112-PA 251 GL14112-PA 93..249 12..162 447 52.2 Plus
Dper\GL13244-PA 229 GL13244-PA 97..226 12..161 316 44 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28677-PA 242 GA28677-PA 122..201 12..91 367 73.8 Plus
Dpse\GA22629-PA 217 GA22629-PA 64..215 10..162 320 39.6 Plus
Dpse\GA28600-PA 229 GA28600-PA 97..226 12..161 317 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25509-PA 165 GM25509-PA 1..155 1..154 679 81.9 Plus
Dsec\GM22525-PA 277 GM22525-PA 119..275 12..162 437 51 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15775-PA 277 GD15775-PA 119..275 12..162 428 49.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18601-PA 272 GJ18601-PA 114..270 9..162 417 48.8 Plus
Dvir\GJ14052-PA 150 GJ14052-PA 8..132 9..127 245 45.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25237-PA 292 GK25237-PA 133..290 11..162 429 48.7 Plus
Dwil\GK22409-PA 1605 GK22409-PA 164..232 2..70 145 34.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16019-PA 277 GE16019-PA 117..274 10..161 445 52.5 Plus

FI06431.hyp Sequence

Translation from 50 to 544

> FI06431.hyp
MSADTFVMDTKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKP
DHTVCPVCKSGVDRSKVIPVYARNDKRQEDPRDKTPPRPTGIWSDYANDL
ELGLFSYLLFGLFFPYGALSSYLDMDEPLNPAADHGIRDGQNETLLSKFF
LYVAIMLIIYMIVI*

FI06431.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG32847-PB 164 CG32847-PB 1..164 1..164 897 100 Plus
CG8974-PE 277 CG8974-PE 117..274 10..161 438 51.3 Plus
CG8974-PD 277 CG8974-PD 117..274 10..161 438 51.3 Plus
CG8974-PB 277 CG8974-PB 117..274 10..161 438 51.3 Plus
CG8974-PA 277 CG8974-PA 117..274 10..161 438 51.3 Plus