BDGP Sequence Production Resources |
Search the DGRC for FI06431
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 64 |
Well: | 31 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32847-RB |
Protein status: | FI06431.pep: gold |
Sequenced Size: | 746 |
Gene | Date | Evidence |
---|---|---|
CG32847 | 2008-08-15 | Release 5.9 accounting |
CG32847 | 2008-12-18 | 5.12 accounting |
746 bp assembled on 2008-07-29
GenBank Submission: BT044276.1
> FI06431.complete ATTAGACTTAAACAAAATTACCTGCGCTAGAAACACACACATCGGAAACA ATGTCGGCTGATACTTTCGTAATGGACACCAAGGATGAATCGTTCTACGA GTGTAACATATGTCTAGACACCGCCCAGAATGCCGTGGTCAGCATGTGTG GCCATTTGTTTTGCTGGCCATGTCTGTACCAATGGATATTGACGAAACCC GATCACACAGTGTGTCCCGTTTGCAAGTCGGGCGTGGATAGGAGCAAAGT AATACCGGTGTACGCACGAAATGATAAAAGGCAGGAGGATCCGCGGGATA AAACACCGCCGCGTCCAACTGGAATTTGGTCGGATTACGCAAATGATCTC GAGTTGGGACTATTTTCGTACTTGCTTTTTGGTTTATTCTTTCCATATGG TGCCCTATCATCTTATCTGGATATGGACGAGCCACTCAATCCTGCTGCTG ATCACGGCATAAGGGATGGGCAGAACGAAACACTCCTTTCTAAGTTCTTT CTCTACGTGGCCATTATGCTCATTATTTATATGATTGTAATTTAGCAAGA ATAGGAATAAGATCAAAATAAACCATGATGGTGCAAATGAATCAGTATAA CCGGGAAGATGTCGTCCTTTACAAATTATGTTCAGTGAAGTTTTCGGATA ATTAGTCATTAATCTTTTTAGTATTGTGTAGCATTATGTAAAACAAATGT AATGAAAAGTAAATATTCAAATGCACTAGGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15111644..15112370 | 1..727 | 3560 | 99.3 | Plus |
chrX | 22417052 | chrX | 15684379..15684557 | 272..94 | 310 | 78.2 | Minus |
chrX | 22417052 | chrX | 15687549..15687727 | 272..94 | 310 | 78.2 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 15114672..15115409 | 1..738 | 3675 | 99.8 | Plus |
X | 23527363 | X | 15805788..15805966 | 272..94 | 310 | 78.2 | Minus |
X | 23527363 | X | 15802618..15802796 | 272..94 | 310 | 78.2 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15111644..15112372 | 1..730 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..495 | 51..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..495 | 51..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..495 | 51..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..495 | 51..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..495 | 51..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..495 | 51..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..730 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..730 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..495 | 51..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32847-RB | 1..730 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15121572..15122301 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15121572..15122301 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15121572..15122301 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15114672..15115401 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15114672..15115401 | 1..730 | 100 | Plus |
Translation from 50 to 544
> FI06431.pep MSADTFVMDTKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKP DHTVCPVCKSGVDRSKVIPVYARNDKRQEDPRDKTPPRPTGIWSDYANDL ELGLFSYLLFGLFFPYGALSSYLDMDEPLNPAADHGIRDGQNETLLSKFF LYVAIMLIIYMIVI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19745-PA | 252 | GF19745-PA | 87..250 | 9..162 | 392 | 47 | Plus |
Dana\GF19854-PA | 189 | GF19854-PA | 113..183 | 12..82 | 309 | 70.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19371-PA | 277 | GG19371-PA | 111..274 | 4..161 | 436 | 48.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12208-PA | 273 | GH12208-PA | 115..271 | 12..162 | 436 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32847-PB | 164 | CG32847-PB | 1..164 | 1..164 | 897 | 100 | Plus |
CG8974-PE | 277 | CG8974-PE | 117..274 | 10..161 | 438 | 51.3 | Plus |
CG8974-PD | 277 | CG8974-PD | 117..274 | 10..161 | 438 | 51.3 | Plus |
CG8974-PB | 277 | CG8974-PB | 117..274 | 10..161 | 438 | 51.3 | Plus |
CG8974-PA | 277 | CG8974-PA | 117..274 | 10..161 | 438 | 51.3 | Plus |
CG8974-PC | 277 | CG8974-PC | 117..274 | 10..161 | 438 | 51.3 | Plus |
CG32581-PB | 283 | CG32581-PB | 117..275 | 10..163 | 389 | 47.5 | Plus |
CG32581-PA | 283 | CG32581-PA | 117..275 | 10..163 | 389 | 47.5 | Plus |
CG34308-PC | 194 | CG34308-PC | 25..92 | 9..76 | 145 | 35.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15740-PA | 285 | GI15740-PA | 124..283 | 9..162 | 435 | 50 | Plus |
Dmoj\GI13710-PA | 151 | GI13710-PA | 1..133 | 8..127 | 223 | 38.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22918-PA | 241 | GL22918-PA | 80..239 | 9..162 | 450 | 51.9 | Plus |
Dper\GL22919-PA | 280 | GL22919-PA | 122..278 | 12..162 | 448 | 52.2 | Plus |
Dper\GL14111-PA | 280 | GL14111-PA | 122..278 | 12..162 | 448 | 52.2 | Plus |
Dper\GL14112-PA | 251 | GL14112-PA | 93..249 | 12..162 | 447 | 52.2 | Plus |
Dper\GL13244-PA | 229 | GL13244-PA | 97..226 | 12..161 | 316 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28677-PA | 242 | GA28677-PA | 122..201 | 12..91 | 367 | 73.8 | Plus |
Dpse\GA22629-PA | 217 | GA22629-PA | 64..215 | 10..162 | 320 | 39.6 | Plus |
Dpse\GA28600-PA | 229 | GA28600-PA | 97..226 | 12..161 | 317 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25509-PA | 165 | GM25509-PA | 1..155 | 1..154 | 679 | 81.9 | Plus |
Dsec\GM22525-PA | 277 | GM22525-PA | 119..275 | 12..162 | 437 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15775-PA | 277 | GD15775-PA | 119..275 | 12..162 | 428 | 49.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18601-PA | 272 | GJ18601-PA | 114..270 | 9..162 | 417 | 48.8 | Plus |
Dvir\GJ14052-PA | 150 | GJ14052-PA | 8..132 | 9..127 | 245 | 45.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25237-PA | 292 | GK25237-PA | 133..290 | 11..162 | 429 | 48.7 | Plus |
Dwil\GK22409-PA | 1605 | GK22409-PA | 164..232 | 2..70 | 145 | 34.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16019-PA | 277 | GE16019-PA | 117..274 | 10..161 | 445 | 52.5 | Plus |
Translation from 50 to 544
> FI06431.hyp MSADTFVMDTKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKP DHTVCPVCKSGVDRSKVIPVYARNDKRQEDPRDKTPPRPTGIWSDYANDL ELGLFSYLLFGLFFPYGALSSYLDMDEPLNPAADHGIRDGQNETLLSKFF LYVAIMLIIYMIVI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32847-PB | 164 | CG32847-PB | 1..164 | 1..164 | 897 | 100 | Plus |
CG8974-PE | 277 | CG8974-PE | 117..274 | 10..161 | 438 | 51.3 | Plus |
CG8974-PD | 277 | CG8974-PD | 117..274 | 10..161 | 438 | 51.3 | Plus |
CG8974-PB | 277 | CG8974-PB | 117..274 | 10..161 | 438 | 51.3 | Plus |
CG8974-PA | 277 | CG8974-PA | 117..274 | 10..161 | 438 | 51.3 | Plus |