Clone FI06434 Report

Search the DGRC for FI06434

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:34
Vector:pOT2
Associated Gene/TranscriptmRpL27-RA
Protein status:FI06434.pep: gold
Sequenced Size:517

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL27 2008-08-15 Release 5.9 accounting
mRpL27 2008-12-18 5.12 accounting

Clone Sequence Records

FI06434.complete Sequence

517 bp assembled on 2008-07-29

GenBank Submission: BT044279.1

> FI06434.complete
AATTGCATAAACAAACCTCGCTACTGGAATAAAATCACAAATATGTCGTT
TAATATCATGCAAAAGCTGACCATGCAGTGCCTGAAGGCAGACCAGCCGC
TGATGACCACCGTGCGCAATGCCAGCAAGAAAACCGGCGGAAGTACGAGG
AATAAGAAGGGCCATGCGAGGCCCAAACATCGCGGATGGCGCGTCCAGGA
TGGGCACCACGTCTCCGAGGGCACAATACTGGCCACCCAGCTCACAACGC
GCTTTCATCCGGGCCTGAATGTGGGCTTTGGCCGCAATGGAACCCTTTTC
GCCATGGAGCACGGCAAGGTTTATGTGACCTGCGAGGCCATCGATCCCAA
CTGGGACCACACCTGGATTCAGCGGAACTACGCCGGTCGCCAGGGCCAGA
ACATCTACAAGAAGTTCTTCAATGTTGTGCCCGAAAATCAGCATCAGCGA
TTTCGTCTAGTGGAGGAAATCTAGATTGTTAAATACAAAATTTAAACCAA
AAAAAAAAAAAAAAAAA

FI06434.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL27.a 795 mRpL27.a 138..638 1..501 2505 100 Plus
mRpL27-RA 795 mRpL27-RA 138..638 1..501 2505 100 Plus
mRpL27.b 926 mRpL27.b 44..544 1..501 2505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4458114..4458341 498..271 1125 99.6 Minus
chr2L 23010047 chr2L 4458398..4458564 273..107 790 98.2 Minus
chr2L 23010047 chr2L 4458619..4458724 106..1 515 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4458977..4459207 501..271 1155 100 Minus
2L 23513712 2L 4459263..4459429 273..107 835 100 Minus
2L 23513712 2L 4459484..4459589 106..1 530 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4458977..4459207 501..271 1155 100 Minus
2L 23513712 2L 4459263..4459429 273..107 835 100 Minus
2L 23513712 2L 4459484..4459589 106..1 530 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:19:04 has no hits.

FI06434.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:51 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4458114..4458341 271..498 99 <- Minus
chr2L 4458401..4458564 107..270 98 <- Minus
chr2L 4458619..4458724 1..106 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:14 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 1..417 58..474 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:05 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 1..417 58..474 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:33 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 1..417 58..474 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:47 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 1..417 58..474 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:50:08 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 1..417 58..474 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:56 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 1..417 58..474 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:05 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 14..511 1..498 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:33 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 14..511 1..498 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 11:46:27 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 1..417 58..474 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:50:08 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL27-RA 14..511 1..498 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:51 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4458980..4459207 271..498 100 <- Minus
2L 4459266..4459429 107..270 100 <- Minus
2L 4459484..4459589 1..106 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:51 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4458980..4459207 271..498 100 <- Minus
2L 4459266..4459429 107..270 100 <- Minus
2L 4459484..4459589 1..106 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:51 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4458980..4459207 271..498 100 <- Minus
2L 4459266..4459429 107..270 100 <- Minus
2L 4459484..4459589 1..106 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:33 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4458980..4459207 271..498 100 <- Minus
arm_2L 4459266..4459429 107..270 100 <- Minus
arm_2L 4459484..4459589 1..106 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:33 Download gff for FI06434.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4458980..4459207 271..498 100 <- Minus
2L 4459266..4459429 107..270 100 <- Minus
2L 4459484..4459589 1..106 100   Minus

FI06434.pep Sequence

Translation from 0 to 473

> FI06434.pep
NCINKPRYWNKITNMSFNIMQKLTMQCLKADQPLMTTVRNASKKTGGSTR
NKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGFGRNGTLF
AMEHGKVYVTCEAIDPNWDHTWIQRNYAGRQGQNIYKKFFNVVPENQHQR
FRLVEEI*

FI06434.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24000-PA 143 GF24000-PA 1..143 15..157 719 90.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24371-PA 138 GG24371-PA 1..138 20..157 731 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13746-PA 138 GH13746-PA 1..138 20..157 665 87 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL27-PC 138 CG33002-PC 1..138 20..157 756 100 Plus
mRpL27-PB 138 CG33002-PB 1..138 20..157 756 100 Plus
mRpL27-PA 138 CG33002-PA 1..138 20..157 756 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17889-PA 138 GI17889-PA 1..138 20..157 667 87 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15397-PA 138 GL15397-PA 1..138 20..157 681 88.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17231-PA 138 GA17231-PA 1..138 20..157 679 87.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18087-PA 143 GM18087-PA 1..143 15..157 755 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22705-PA 143 GD22705-PA 1..143 15..157 764 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17391-PA 143 GJ17391-PA 1..143 15..157 703 88.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24353-PA 143 GK24353-PA 1..143 15..157 682 84.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14710-PA 143 GE14710-PA 1..143 15..157 758 97.9 Plus

FI06434.hyp Sequence

Translation from 0 to 473

> FI06434.hyp
NCINKPRYWNKITNMSFNIMQKLTMQCLKADQPLMTTVRNASKKTGGSTR
NKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGFGRNGTLF
AMEHGKVYVTCEAIDPNWDHTWIQRNYAGRQGQNIYKKFFNVVPENQHQR
FRLVEEI*

FI06434.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL27-PC 138 CG33002-PC 1..138 20..157 756 100 Plus
mRpL27-PB 138 CG33002-PB 1..138 20..157 756 100 Plus
mRpL27-PA 138 CG33002-PA 1..138 20..157 756 100 Plus