Clone FI06435 Report

Search the DGRC for FI06435

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:35
Vector:pOT2
Associated Gene/TranscriptCG32945-RA
Protein status:FI06435.pep: gold
Sequenced Size:727

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32945 2008-08-15 Release 5.9 accounting
CG32945 2008-12-18 5.12 accounting

Clone Sequence Records

FI06435.complete Sequence

727 bp assembled on 2008-07-29

GenBank Submission: BT044280.1

> FI06435.complete
CCAAAACGAAGAACAAATTAAAAAAAAAATAAGGAAATAATATTCTCAGA
CATGGGTGCTGGGAACAGCAAGCCGCAAACGGTGCAGATTGAAAATCCAA
CGGCATTTGAGATTACTCGGGATGTGGTAGATAGAATAAAGCAGGCCACC
GTCATAAGTACTGAACTCGGATCTACCACCTGTGAAGCGTGTAAGCAAAA
ACCAATAAAAGAATCGTGTTCCGATATACGTACTCCGATGGAACATAAGC
AGCATAATGTGAGTGCCTTACATCCAGTTCCGGTGGCCAAGTCCTGGAAG
AAGCGTTCTTTGGAAGTCGAGGAAAAAGAGTTCGGAAAATCCTTAAAATT
GGTTCAAGAACTATTCGGTACGCCTGTAAAATGGGCCAAGGATTGCGAGG
GCGAGATCGAAAAATTCGAGGAAGAGCTGGTTCACTGCTATCAACGGTTT
CCAAACGAACCCCTTCAGTGCTCTAATTTGGCCAGACAGTATCACCGATT
CGTATTCGCCAAACAGTATGCCGAATTATCGAAAACCAATACATGTACTT
AAAGATAGGCGATCGACGATCTTAATAATCCATTTAAGGTCAAAAGCCAA
AAACTTTTATCCTACTCCATAGGATAAAAGACGCTTAGTTAATTTTAGAG
TTTTAGAATTTTCAGTTTTGGGAATTTTTAATTAAATGTAACGTGGTGAA
ACCTTTAAAAAAAAAAAAAAAAAAAAA

FI06435.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32945-RA 501 CG32945-RA 1..501 52..552 2505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 403657..404362 706..1 3530 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4577938..4578644 707..1 3535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4318769..4319475 707..1 3535 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:18:42 has no hits.

FI06435.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:38 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 403657..404362 1..706 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:15 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..501 52..552 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:25 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..501 52..552 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:09 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..501 52..552 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:32 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..501 52..552 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:44 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..501 52..552 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:36 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..501 52..552 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:25 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..706 1..706 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:09 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..706 1..706 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:20:24 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..501 52..552 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:44 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
CG32945-RA 1..706 1..706 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:38 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4577939..4578644 1..706 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:38 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4577939..4578644 1..706 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:38 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4577939..4578644 1..706 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:09 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 403661..404366 1..706 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:41 Download gff for FI06435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4318770..4319475 1..706 100   Minus

FI06435.hyp Sequence

Translation from 51 to 551

> FI06435.hyp
MGAGNSKPQTVQIENPTAFEITRDVVDRIKQATVISTELGSTTCEACKQK
PIKESCSDIRTPMEHKQHNVSALHPVPVAKSWKKRSLEVEEKEFGKSLKL
VQELFGTPVKWAKDCEGEIEKFEEELVHCYQRFPNEPLQCSNLARQYHRF
VFAKQYAELSKTNTCT*

FI06435.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32945-PA 166 CG32945-PA 1..166 1..166 882 100 Plus

FI06435.pep Sequence

Translation from 51 to 551

> FI06435.pep
MGAGNSKPQTVQIENPTAFEITRDVVDRIKQATVISTELGSTTCEACKQK
PIKESCSDIRTPMEHKQHNVSALHPVPVAKSWKKRSLEVEEKEFGKSLKL
VQELFGTPVKWAKDCEGEIEKFEEELVHCYQRFPNEPLQCSNLARQYHRF
VFAKQYAELSKTNTCT*

FI06435.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16661-PA 190 GF16661-PA 1..164 1..161 458 54.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11477-PA 166 GG11477-PA 1..166 1..166 760 86.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24466-PA 180 GH24466-PA 1..156 1..155 313 41 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG32945-PA 166 CG32945-PA 1..166 1..166 882 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16041-PA 185 GI16041-PA 1..172 1..162 331 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22069-PA 195 GL22069-PA 1..162 1..161 352 43.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17209-PA 195 GA17209-PA 1..162 1..161 343 42.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10695-PA 166 GM10695-PA 1..166 1..166 734 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19669-PA 166 GD19669-PA 1..166 1..166 736 91.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15553-PA 197 GJ15553-PA 1..180 1..159 336 38.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10053-PA 221 GK10053-PA 1..201 1..164 326 36.1 Plus
Dwil\GK10104-PA 230 GK10104-PA 1..208 1..164 318 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11149-PA 168 GE11149-PA 1..166 1..166 673 85.5 Plus