Clone FI06437 Report

Search the DGRC for FI06437

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:37
Vector:pOT2
Associated Gene/TranscriptCG12511-RC
Protein status:FI06437.pep: gold
Sequenced Size:512

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12511 2008-12-18 5.12 accounting

Clone Sequence Records

FI06437.complete Sequence

512 bp assembled on 2008-10-24

GenBank Submission: BT050486.1

> FI06437.complete
GAAGACGCAAAAACAGCTGAAATGAGTGACTTACCAGTGGTGAAGAGCAG
TACCCATGAATAGCCTTAGCCAGAGGTCGCCGTACAGCCAGATCGGGATG
GGAGCTGCCGGTGGTTTTCTCACCGGCTTCGTGCTCCTCAAGGCGAGTAA
GATTATGGCCGTGGCCGCTGGCGGTACCATTCTGGCGCTCGAGCTGGCAT
GGCAGGCGGGACTGGTCCAGCTGGATGTGCTCAAGACATTCTCACAGCTG
GAACAGGATCAGTCCCGGGGGCAGCTAGAGGTCAGAGAAATATCCCTGGA
GCCAGTGAATCTTAACCGCGTTCAGGAACTTGGGGATAAAGCCAGGAAGG
CGTGTGCAACCAGCGGTCGTCTATGTGTGGCCTTCTTGGGCGGCTTTCTA
CTCGGCTTTGGATGGGCTTAAGTAATACAAATTATGATCGCAAACACACA
TATACACAATATTTAAGTTGATGTAAACGAAAGTTTTCACCTGTAAAAAA
AAAAAAAAAAAA

FI06437.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG12511.a 657 CG12511.a 103..597 1..495 2475 100 Plus
nc_1190.a 509 nc_1190.a 40..509 1..474 2285 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5677880..5678320 54..494 2205 100 Plus
chr2L 23010047 chr2L 5677774..5677826 1..53 265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5678783..5679224 54..495 2210 100 Plus
2L 23513712 2L 5678677..5678729 1..53 265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5678783..5679224 54..495 2210 100 Plus
2L 23513712 2L 5678677..5678729 1..53 265 100 Plus
Blast to na_te.dros performed 2019-03-16 01:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 1441..1481 446..486 115 75.6 Plus

FI06437.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:38:43 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5677774..5677826 1..53 100 -> Plus
chr2L 5677880..5678320 54..494 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:16 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RA 1..366 56..421 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:16:22 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RB 1..396 22..421 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:41:38 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RB 1..396 22..421 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:39:01 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RB 1..396 22..421 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:53 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RA 1..366 56..421 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:16:22 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RC 40..533 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:41:38 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RC 96..589 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-24 12:24:46 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RA 1..366 56..421 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:39:01 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
CG12511-RC 96..589 1..494 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:43 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5678783..5679223 54..494 100   Plus
2L 5678677..5678729 1..53 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:43 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5678783..5679223 54..494 100   Plus
2L 5678677..5678729 1..53 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:43 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5678783..5679223 54..494 100   Plus
2L 5678677..5678729 1..53 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:41:38 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5678677..5678729 1..53 100 -> Plus
arm_2L 5678783..5679223 54..494 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:47:19 Download gff for FI06437.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5678783..5679223 54..494 100   Plus
2L 5678677..5678729 1..53 100 -> Plus

FI06437.pep Sequence

Translation from 55 to 420

> FI06437.pep
MNSLSQRSPYSQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQ
AGLVQLDVLKTFSQLEQDQSRGQLEVREISLEPVNLNRVQELGDKARKAC
ATSGRLCVAFLGGFLLGFGWA*

FI06437.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15576-PA 116 GF15576-PA 1..116 1..121 308 63.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25089-PA 121 GG25089-PA 1..121 1..121 499 88.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11039-PA 122 GH11039-PA 11..122 4..121 190 38.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12511-PD 121 CG12511-PD 1..121 1..121 604 100 Plus
CG12511-PC 121 CG12511-PC 1..121 1..121 604 100 Plus
CG12511-PB 131 CG12511-PB 11..131 1..121 604 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17557-PA 126 GI17557-PA 11..115 1..110 162 32.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26373-PA 124 GL26373-PA 6..124 2..121 208 40.8 Plus
Dper\GL26375-PA 132 GL26375-PA 14..132 4..121 208 43 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11671-PA 124 GA11671-PA 6..124 2..121 215 42.5 Plus
Dpse\GA28836-PA 132 GA28836-PA 14..132 4..121 205 42.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18565-PA 121 GM18565-PA 1..121 1..121 505 93.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23356-PA 121 GD23356-PA 1..121 1..121 498 92.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15573-PA 136 GJ15573-PA 12..124 2..109 192 41.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19026-PA 135 GK19026-PA 11..123 1..109 190 43 Plus
Dwil\GK18998-PA 155 GK18998-PA 10..87 1..78 133 38.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25559-PA 122 GE25559-PA 1..122 1..121 481 89.3 Plus

FI06437.hyp Sequence

Translation from 55 to 420

> FI06437.hyp
MNSLSQRSPYSQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQ
AGLVQLDVLKTFSQLEQDQSRGQLEVREISLEPVNLNRVQELGDKARKAC
ATSGRLCVAFLGGFLLGFGWA*

FI06437.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG12511-PD 121 CG12511-PD 1..121 1..121 604 100 Plus
CG12511-PC 121 CG12511-PC 1..121 1..121 604 100 Plus
CG12511-PB 131 CG12511-PB 11..131 1..121 604 100 Plus