BDGP Sequence Production Resources |
Search the DGRC for FI06437
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 64 |
Well: | 37 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12511-RC |
Protein status: | FI06437.pep: gold |
Sequenced Size: | 512 |
Gene | Date | Evidence |
---|---|---|
CG12511 | 2008-12-18 | 5.12 accounting |
512 bp assembled on 2008-10-24
GenBank Submission: BT050486.1
> FI06437.complete GAAGACGCAAAAACAGCTGAAATGAGTGACTTACCAGTGGTGAAGAGCAG TACCCATGAATAGCCTTAGCCAGAGGTCGCCGTACAGCCAGATCGGGATG GGAGCTGCCGGTGGTTTTCTCACCGGCTTCGTGCTCCTCAAGGCGAGTAA GATTATGGCCGTGGCCGCTGGCGGTACCATTCTGGCGCTCGAGCTGGCAT GGCAGGCGGGACTGGTCCAGCTGGATGTGCTCAAGACATTCTCACAGCTG GAACAGGATCAGTCCCGGGGGCAGCTAGAGGTCAGAGAAATATCCCTGGA GCCAGTGAATCTTAACCGCGTTCAGGAACTTGGGGATAAAGCCAGGAAGG CGTGTGCAACCAGCGGTCGTCTATGTGTGGCCTTCTTGGGCGGCTTTCTA CTCGGCTTTGGATGGGCTTAAGTAATACAAATTATGATCGCAAACACACA TATACACAATATTTAAGTTGATGTAAACGAAAGTTTTCACCTGTAAAAAA AAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
accord | 7404 | accord ACCORD 7404bp | 1441..1481 | 446..486 | 115 | 75.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 5677774..5677826 | 1..53 | 100 | -> | Plus |
chr2L | 5677880..5678320 | 54..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RA | 1..366 | 56..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RB | 1..396 | 22..421 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RB | 1..396 | 22..421 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RB | 1..396 | 22..421 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RA | 1..366 | 56..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RC | 40..533 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RC | 96..589 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RA | 1..366 | 56..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12511-RC | 96..589 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5678783..5679223 | 54..494 | 100 | Plus | |
2L | 5678677..5678729 | 1..53 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5678783..5679223 | 54..494 | 100 | Plus | |
2L | 5678677..5678729 | 1..53 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5678783..5679223 | 54..494 | 100 | Plus | |
2L | 5678677..5678729 | 1..53 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 5678677..5678729 | 1..53 | 100 | -> | Plus |
arm_2L | 5678783..5679223 | 54..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5678783..5679223 | 54..494 | 100 | Plus | |
2L | 5678677..5678729 | 1..53 | 100 | -> | Plus |
Translation from 55 to 420
> FI06437.pep MNSLSQRSPYSQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQ AGLVQLDVLKTFSQLEQDQSRGQLEVREISLEPVNLNRVQELGDKARKAC ATSGRLCVAFLGGFLLGFGWA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15576-PA | 116 | GF15576-PA | 1..116 | 1..121 | 308 | 63.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25089-PA | 121 | GG25089-PA | 1..121 | 1..121 | 499 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11039-PA | 122 | GH11039-PA | 11..122 | 4..121 | 190 | 38.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12511-PD | 121 | CG12511-PD | 1..121 | 1..121 | 604 | 100 | Plus |
CG12511-PC | 121 | CG12511-PC | 1..121 | 1..121 | 604 | 100 | Plus |
CG12511-PB | 131 | CG12511-PB | 11..131 | 1..121 | 604 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17557-PA | 126 | GI17557-PA | 11..115 | 1..110 | 162 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26373-PA | 124 | GL26373-PA | 6..124 | 2..121 | 208 | 40.8 | Plus |
Dper\GL26375-PA | 132 | GL26375-PA | 14..132 | 4..121 | 208 | 43 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11671-PA | 124 | GA11671-PA | 6..124 | 2..121 | 215 | 42.5 | Plus |
Dpse\GA28836-PA | 132 | GA28836-PA | 14..132 | 4..121 | 205 | 42.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18565-PA | 121 | GM18565-PA | 1..121 | 1..121 | 505 | 93.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23356-PA | 121 | GD23356-PA | 1..121 | 1..121 | 498 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15573-PA | 136 | GJ15573-PA | 12..124 | 2..109 | 192 | 41.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19026-PA | 135 | GK19026-PA | 11..123 | 1..109 | 190 | 43 | Plus |
Dwil\GK18998-PA | 155 | GK18998-PA | 10..87 | 1..78 | 133 | 38.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25559-PA | 122 | GE25559-PA | 1..122 | 1..121 | 481 | 89.3 | Plus |
Translation from 55 to 420
> FI06437.hyp MNSLSQRSPYSQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQ AGLVQLDVLKTFSQLEQDQSRGQLEVREISLEPVNLNRVQELGDKARKAC ATSGRLCVAFLGGFLLGFGWA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12511-PD | 121 | CG12511-PD | 1..121 | 1..121 | 604 | 100 | Plus |
CG12511-PC | 121 | CG12511-PC | 1..121 | 1..121 | 604 | 100 | Plus |
CG12511-PB | 131 | CG12511-PB | 11..131 | 1..121 | 604 | 100 | Plus |