BDGP Sequence Production Resources |
Search the DGRC for FI06438
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 64 |
Well: | 38 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14321-RA |
Protein status: | FI06438.pep: gold |
Sequenced Size: | 698 |
Gene | Date | Evidence |
---|---|---|
CG14321 | 2008-08-15 | Release 5.9 accounting |
CG14321 | 2008-12-18 | 5.12 accounting |
698 bp assembled on 2008-07-29
GenBank Submission: BT044281.1
> FI06438.complete GGGTAAGGAAAATGACGCGTCCTGCGATTTTCCTCGTTGTCTGCTCAATA ACTCTGCTTAATTCCGTCAATGGCTACAAGGAGATCCATGGAATGAATGG CAAGCTGTTTCCGAAGGCGGCGACGTTTAATTTTCCCGAATATGCTTACA AGGAGACCAGCAAAAATGAAATCACTTACCACGAACTGGAGGTGACCTGT GACCAGCACGCCCAGTGCATTGGCCTTAGTCCGGTGGGCGTGGCCAAGAT CAACTGCATCCGACAGTGCATTTCGCCATCGTGCTACCAGGACATCTATG CCTTCAACGAGCTGGAGGAGGGCGAAATCGACGCCAGGCTGAACTCCTTT AAGGGATGCGTTATCCAACGCATGTAGCAGCGACCGCAGTTGTTCAAGGA GTGCTTCATCTTCAAGTGGCTGGAGCTCACTGGCATCGCCTACTAAATGG ACCCAATGCCGATCCGTTTCGAGCACTTGCAGTTGATGGAGCTATTGGCT GTTGACTGCGAAGATAACACACAGGAGCCTCTTTCTACCAAATGCCCATT TGGATGTGAGAGGCTTCGGCGGCATCATCTGTGCAATGAAATGAACTCTT ACATCGCATCTGCGATCGGTTGACTGCCCCTTGACTTAAGGCCAAATTTA GAAATAAACTTTTTCACTAATATAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14321.a | 768 | CG14321.a | 80..758 | 1..679 | 3395 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 13557989..13558155 | 1..167 | 98 | -> | Plus |
chr3R | 13558238..13558743 | 168..673 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 1..366 | 12..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 1..366 | 12..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 1..366 | 12..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 1..366 | 12..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 1..366 | 12..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 1..366 | 12..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 28..700 | 1..673 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 30..702 | 1..673 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 1..366 | 12..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14321-RA | 30..702 | 1..673 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17733627..17733793 | 1..167 | 100 | -> | Plus |
3R | 17733876..17734381 | 168..673 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17733627..17733793 | 1..167 | 100 | -> | Plus |
3R | 17733876..17734381 | 168..673 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17733627..17733793 | 1..167 | 100 | -> | Plus |
3R | 17733876..17734381 | 168..673 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 13559349..13559515 | 1..167 | 100 | -> | Plus |
arm_3R | 13559598..13560103 | 168..673 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17474707..17475212 | 168..673 | 100 | Plus | |
3R | 17474458..17474624 | 1..167 | 100 | -> | Plus |
Translation from 2 to 376
> FI06438.hyp VRKMTRPAIFLVVCSITLLNSVNGYKEIHGMNGKLFPKAATFNFPEYAYK ETSKNEITYHELEVTCDQHAQCIGLSPVGVAKINCIRQCISPSCYQDIYA FNELEEGEIDARLNSFKGCVIQRM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14321-PA | 121 | CG14321-PA | 1..121 | 4..124 | 647 | 100 | Plus |
Translation from 2 to 376
> FI06438.pep VRKMTRPAIFLVVCSITLLNSVNGYKEIHGMNGKLFPKAATFNFPEYAYK ETSKNEITYHELEVTCDQHAQCIGLSPVGVAKINCIRQCISPSCYQDIYA FNELEEGEIDARLNSFKGCVIQRM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16851-PA | 121 | GF16851-PA | 1..118 | 4..120 | 479 | 75.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22482-PA | 121 | GG22482-PA | 1..121 | 4..124 | 615 | 93.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17284-PA | 117 | GH17284-PA | 25..117 | 32..124 | 386 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14321-PA | 121 | CG14321-PA | 1..121 | 4..124 | 647 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23957-PA | 119 | GI23957-PA | 1..119 | 4..124 | 346 | 57.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11860-PA | 120 | GL11860-PA | 1..120 | 4..124 | 465 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25146-PA | 120 | GA25146-PA | 1..120 | 4..124 | 465 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15261-PA | 121 | GM15261-PA | 1..121 | 4..124 | 625 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19185-PA | 123 | GD19185-PA | 1..123 | 4..124 | 615 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11114-PA | 118 | GJ11114-PA | 26..118 | 32..124 | 359 | 69.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22660-PA | 121 | GK22660-PA | 7..121 | 10..124 | 470 | 74.8 | Plus |
Dwil\GK22265-PA | 121 | GK22265-PA | 7..121 | 10..124 | 470 | 74.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25497-PA | 121 | GE25497-PA | 1..121 | 4..124 | 615 | 94.2 | Plus |