Clone FI06438 Report

Search the DGRC for FI06438

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:38
Vector:pOT2
Associated Gene/TranscriptCG14321-RA
Protein status:FI06438.pep: gold
Sequenced Size:698

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14321 2008-08-15 Release 5.9 accounting
CG14321 2008-12-18 5.12 accounting

Clone Sequence Records

FI06438.complete Sequence

698 bp assembled on 2008-07-29

GenBank Submission: BT044281.1

> FI06438.complete
GGGTAAGGAAAATGACGCGTCCTGCGATTTTCCTCGTTGTCTGCTCAATA
ACTCTGCTTAATTCCGTCAATGGCTACAAGGAGATCCATGGAATGAATGG
CAAGCTGTTTCCGAAGGCGGCGACGTTTAATTTTCCCGAATATGCTTACA
AGGAGACCAGCAAAAATGAAATCACTTACCACGAACTGGAGGTGACCTGT
GACCAGCACGCCCAGTGCATTGGCCTTAGTCCGGTGGGCGTGGCCAAGAT
CAACTGCATCCGACAGTGCATTTCGCCATCGTGCTACCAGGACATCTATG
CCTTCAACGAGCTGGAGGAGGGCGAAATCGACGCCAGGCTGAACTCCTTT
AAGGGATGCGTTATCCAACGCATGTAGCAGCGACCGCAGTTGTTCAAGGA
GTGCTTCATCTTCAAGTGGCTGGAGCTCACTGGCATCGCCTACTAAATGG
ACCCAATGCCGATCCGTTTCGAGCACTTGCAGTTGATGGAGCTATTGGCT
GTTGACTGCGAAGATAACACACAGGAGCCTCTTTCTACCAAATGCCCATT
TGGATGTGAGAGGCTTCGGCGGCATCATCTGTGCAATGAAATGAACTCTT
ACATCGCATCTGCGATCGGTTGACTGCCCCTTGACTTAAGGCCAAATTTA
GAAATAAACTTTTTCACTAATATAAAAAAAAAAAAAAAAAAAAAAAAA

FI06438.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321.a 768 CG14321.a 80..758 1..679 3395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13558238..13558743 168..673 2515 99.8 Plus
chr3R 27901430 chr3R 13557989..13558156 1..168 810 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17733876..17734387 168..679 2560 100 Plus
3R 32079331 3R 17733627..17733794 1..168 840 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17474707..17475218 168..679 2560 100 Plus
3R 31820162 3R 17474458..17474625 1..168 840 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:25:15 has no hits.

FI06438.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:26:04 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13557989..13558155 1..167 98 -> Plus
chr3R 13558238..13558743 168..673 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:18 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 1..366 12..377 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:58 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 1..366 12..377 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:28:13 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 1..366 12..377 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:44 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 1..366 12..377 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:04 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 1..366 12..377 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:32 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 1..366 12..377 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:57 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 28..700 1..673 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:28:13 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 30..702 1..673 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 10:12:52 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 1..366 12..377 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:04 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 30..702 1..673 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:04 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17733627..17733793 1..167 100 -> Plus
3R 17733876..17734381 168..673 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:04 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17733627..17733793 1..167 100 -> Plus
3R 17733876..17734381 168..673 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:04 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17733627..17733793 1..167 100 -> Plus
3R 17733876..17734381 168..673 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:28:13 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13559349..13559515 1..167 100 -> Plus
arm_3R 13559598..13560103 168..673 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:24 Download gff for FI06438.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17474707..17475212 168..673 100   Plus
3R 17474458..17474624 1..167 100 -> Plus

FI06438.hyp Sequence

Translation from 2 to 376

> FI06438.hyp
VRKMTRPAIFLVVCSITLLNSVNGYKEIHGMNGKLFPKAATFNFPEYAYK
ETSKNEITYHELEVTCDQHAQCIGLSPVGVAKINCIRQCISPSCYQDIYA
FNELEEGEIDARLNSFKGCVIQRM*

FI06438.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321-PA 121 CG14321-PA 1..121 4..124 647 100 Plus

FI06438.pep Sequence

Translation from 2 to 376

> FI06438.pep
VRKMTRPAIFLVVCSITLLNSVNGYKEIHGMNGKLFPKAATFNFPEYAYK
ETSKNEITYHELEVTCDQHAQCIGLSPVGVAKINCIRQCISPSCYQDIYA
FNELEEGEIDARLNSFKGCVIQRM*

FI06438.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16851-PA 121 GF16851-PA 1..118 4..120 479 75.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22482-PA 121 GG22482-PA 1..121 4..124 615 93.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17284-PA 117 GH17284-PA 25..117 32..124 386 73.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321-PA 121 CG14321-PA 1..121 4..124 647 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23957-PA 119 GI23957-PA 1..119 4..124 346 57.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11860-PA 120 GL11860-PA 1..120 4..124 465 72.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25146-PA 120 GA25146-PA 1..120 4..124 465 72.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15261-PA 121 GM15261-PA 1..121 4..124 625 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19185-PA 123 GD19185-PA 1..123 4..124 615 95.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11114-PA 118 GJ11114-PA 26..118 32..124 359 69.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22660-PA 121 GK22660-PA 7..121 10..124 470 74.8 Plus
Dwil\GK22265-PA 121 GK22265-PA 7..121 10..124 470 74.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25497-PA 121 GE25497-PA 1..121 4..124 615 94.2 Plus