Clone FI06444 Report

Search the DGRC for FI06444

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:44
Vector:pOT2
Associated Gene/Transcripttomboy20-RA
Protein status:FI06444.pep: gold
Sequenced Size:654

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
tomboy20 2008-08-15 Release 5.9 accounting
tomboy20 2008-12-18 5.12 accounting

Clone Sequence Records

FI06444.complete Sequence

654 bp assembled on 2008-07-29

GenBank Submission: BT044282.1

> FI06444.complete
AGGGTTTGACTTTTCAACAAGGAGAAACAGAAATACGTAAAGAATTAAAT
TCGAAAATGATTGGAGTCTCGGGAACTTTCAAGGTGCTGGCGGCCATATC
GGGTATACTCTTCATGGGCTATTGCGTATATTTCGACAAACAGCGTCGGA
GTGATCCAGATTTCAAGAGGAAGTTGCACGAGCGCAGGATTCAACGCTCA
TTGGCATCCGTGAAGTCCACGGCATCGGTTTCCATGAGCGAGCGGGACGT
CGAAGTGTACTTCATGACCCAGATACACAAGGGCGAGACCCTGATCACAA
ACGGCGATGTTGAGGCCGGCGTGGAGCATCTAATCAACGCGATACTCGTC
TGCGGCCAGCCGTCAAAACTGTTGCAGTTGCTCCAGAGCACCTTGCCCAT
GGATATTTTCACCACAATGCTGATCAAGATGCACGCCTACGAGGCCTCGC
AGCGCTGTTTGCCTGTTTTAGTGGATGATGAGGCTACCAGTAGCCTTTGA
AATACTCCAAAATTGATGGTCTCTGTTTTTTCTCGAACAAAACGATAACT
TTTTTGAGAGCTGCGTCTCAAGTAGCTAAATACATTTCTTTGGTTCACGT
ATCTCGGGCAAATACATACAATGTATACTCGTAAAAAAAAAAAAAAAAAA
AAAA

FI06444.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
tomboy20-RA 681 tomboy20-RA 50..681 1..632 3160 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6560793..6561424 632..1 3145 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10735276..10735908 633..1 3165 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10476107..10476739 633..1 3165 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:14:48 has no hits.

FI06444.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:15:35 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6560793..6561424 1..632 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:24 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 1..444 57..500 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:30 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 1..444 57..500 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:48 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 1..444 57..500 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:17 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 1..444 57..500 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:35:11 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 1..444 57..500 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:27:06 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 50..612 1..563 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:30 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 50..612 1..563 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:48 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 50..681 1..632 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:41 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 50..612 1..563 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:35:11 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
tomboy20-RA 50..681 1..632 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:15:35 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10735277..10735908 1..632 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:15:35 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10735277..10735908 1..632 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:15:35 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10735277..10735908 1..632 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:48 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6560999..6561630 1..632 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:55 Download gff for FI06444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10476108..10476739 1..632 100   Minus

FI06444.hyp Sequence

Translation from 2 to 499

> FI06444.hyp
GLTFQQGETEIRKELNSKMIGVSGTFKVLAAISGILFMGYCVYFDKQRRS
DPDFKRKLHERRIQRSLASVKSTASVSMSERDVEVYFMTQIHKGETLITN
GDVEAGVEHLINAILVCGQPSKLLQLLQSTLPMDIFTTMLIKMHAYEASQ
RCLPVLVDDEATSSL*

FI06444.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
tomboy20-PA 147 CG14690-PA 1..147 19..165 738 100 Plus
Tom20-PB 171 CG7654-PB 3..130 14..146 334 45.5 Plus
Tom20-PA 171 CG7654-PA 3..130 14..146 334 45.5 Plus

FI06444.pep Sequence

Translation from 2 to 499

> FI06444.pep
GLTFQQGETEIRKELNSKMIGVSGTFKVLAAISGILFMGYCVYFDKQRRS
DPDFKRKLHERRIQRSLASVKSTASVSMSERDVEVYFMTQIHKGETLITN
GDVEAGVEHLINAILVCGQPSKLLQLLQSTLPMDIFTTMLIKMHAYEASQ
RCLPVLVDDEATSSL*

FI06444.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17442-PA 145 GF17442-PA 3..144 25..165 507 64.8 Plus
Dana\GF23612-PA 170 GF23612-PA 3..130 14..146 314 44 Plus
Dana\GF20199-PA 144 GF20199-PA 16..137 31..143 275 39.3 Plus
Dana\GF20479-PA 146 GF20479-PA 17..128 36..148 220 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17273-PA 148 GG17273-PA 1..147 19..165 648 80.3 Plus
Dere\GG16077-PA 171 GG16077-PA 3..130 14..146 316 45.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17358-PA 157 GH17358-PA 10..144 25..159 321 43.1 Plus
Dgri\GH14388-PA 168 GH14388-PA 3..130 14..146 305 44.8 Plus
Dgri\GH17969-PA 159 GH17969-PA 12..130 31..143 253 37 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
tomboy20-PA 147 CG14690-PA 1..147 19..165 738 100 Plus
Tom20-PB 171 CG7654-PB 3..130 14..146 334 45.5 Plus
Tom20-PA 171 CG7654-PA 3..130 14..146 334 45.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23896-PA 157 GI23896-PA 1..131 19..146 327 46.2 Plus
Dmoj\GI11331-PA 169 GI11331-PA 3..130 14..146 313 45.5 Plus
Dmoj\GI21634-PA 150 GI21634-PA 11..130 30..143 246 38.3 Plus
Dmoj\GI21625-PA 175 GI21625-PA 17..145 36..149 227 34.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:33:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11896-PA 166 GL11896-PA 3..130 14..146 309 44.8 Plus
Dper\GL12626-PA 172 GL12626-PA 2..150 22..150 263 37.1 Plus
Dper\GL23695-PA 189 GL23695-PA 5..143 24..151 257 33.3 Plus
Dper\GL25092-PA 243 GL25092-PA 7..160 28..143 221 30.5 Plus
Dper\GL19377-PA 200 GL19377-PA 8..158 29..143 204 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:33:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29327-PA 166 GA29327-PA 3..130 14..146 309 44.8 Plus
Dpse\GA29170-PA 228 GA29170-PA 4..144 23..143 272 34.8 Plus
Dpse\GA27573-PA 172 GA27573-PA 2..150 22..150 259 36.4 Plus
Dpse\GA26707-PA 186 GA26707-PA 5..153 24..164 253 33.1 Plus
Dpse\GA22942-PA 243 GA22942-PA 13..160 34..143 211 29.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26157-PA 147 GM26157-PA 1..147 19..165 708 88.4 Plus
Dsec\GM19743-PA 171 GM19743-PA 3..130 14..146 317 45.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20710-PA 147 GD20710-PA 1..147 19..165 705 87.8 Plus
Dsim\GD14848-PA 171 GD14848-PA 3..130 14..146 317 45.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23989-PA 157 GJ23989-PA 1..144 19..159 351 43.1 Plus
Dvir\GJ11588-PA 169 GJ11588-PA 3..130 14..146 309 44.8 Plus
Dvir\GJ16865-PA 153 GJ16865-PA 11..133 30..143 244 39 Plus
Dvir\GJ16867-PA 164 GJ16867-PA 17..160 33..164 240 34.5 Plus
Dvir\GJ18805-PA 168 GJ18805-PA 1..119 19..140 207 30.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19183-PA 172 GK19183-PA 11..144 28..157 316 41 Plus
Dwil\GK18666-PA 165 GK18666-PA 1..127 15..146 306 45.1 Plus
Dwil\GK16485-PA 180 GK16485-PA 19..150 38..143 238 35.6 Plus
Dwil\GK16136-PA 195 GK16136-PA 9..156 28..146 227 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24674-PA 148 GE24674-PA 1..147 19..165 645 79.6 Plus
Dyak\GE19643-PA 171 GE19643-PA 3..130 14..146 315 45.5 Plus
Dyak\GE23225-PA 168 GE23225-PA 1..127 15..146 310 45.1 Plus