Clone FI06445 Report

Search the DGRC for FI06445

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:45
Vector:pOT2
Associated Gene/TranscriptCG15653-RA
Protein status:FI06445.pep: Imported from assembly
Sequenced Size:648

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15653 2008-08-15 Release 5.9 accounting
CG15653 2008-12-18 5.12 accounting

Clone Sequence Records

FI06445.complete Sequence

648 bp assembled on 2008-07-29

GenBank Submission: BT044283.1

> FI06445.complete
GTTGGACTCAAGTTTCCGTCGAACCGAACACTGGGCAATATTTGTGTCTA
CGGTGCGGTGGCCTCCATATCCGCTGTGATGTACATGAAATGGAAGATGG
AGGATCGGGTGAAATCCGCAGAGTACTACAAACTGGCCTTGAAGGCACTG
CGGAGCCATCGAGGAGCAGTTGGTCTCCTGGGTGAACCCATCAAGGACTC
TGGCATCGATCTGTCCAACGCCAACAACAATTGCAATGCGGAGGAGGCGC
GTTGTGAGGTGGCTGTGCGGGGCAGCAAGGATAAAGGAACTTTATACTTT
TGGGCGTCCAATCAGCCGGATAGAGGCTGGCTGATCGATCGACTGGAGCT
GGAAACAAAACTCAACCCAGAGAAACGATTTTTGCTTAAAAAATCCGAGG
AACTAACCTTCGATCTGCCCGAGAGTATAACCAAACAAACTGCCCAGCAA
GTTGATTCCAATGTCATTCTATCCGCATCGGATCAACAACCAGAAACACA
TTCAAAGTGAAGACAATCCGAATGTCCGATTCAATTAGTTTATTCTCTTT
AAATTTGACTAATTCAAGCAATCTTAAATGTTTTATAGTTATGTTATTTT
AATTACAAATTTATTGTTTTTATAAAATCAAAAAAAAAAAAAAAAAAA

FI06445.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15653-RA 898 CG15653-RA 270..898 1..629 3145 100 Plus
cpa-RA 2047 cpa-RA 1939..2047 632..524 545 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16946213..16946557 629..285 1635 98.3 Minus
chr2R 21145070 chr2R 16946612..16946898 287..1 1390 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21059777..21060124 632..285 1740 100 Minus
2R 25286936 2R 21060179..21060465 287..1 1435 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21060976..21061323 632..285 1740 100 Minus
2R 25260384 2R 21061378..21061664 287..1 1435 100 Minus
Blast to na_te.dros performed 2019-03-16 09:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 243..334 625..536 122 60.9 Minus

FI06445.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:16:22 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16946613..16946898 1..286 98   Minus
chr2R 16946249..16946555 287..593 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:25 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 4..513 1..510 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:32 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 4..513 1..510 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:58:59 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 4..513 1..510 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:55 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 4..513 1..510 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:23 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 4..513 1..510 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:32 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 4..513 1..510 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:31 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 45..673 1..629 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:58:59 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 83..711 1..629 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:33 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 4..513 1..510 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:23 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
CG15653-RA 83..711 1..629 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:22 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21059780..21060122 287..629 100 <- Minus
2R 21060180..21060465 1..286 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:22 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21059780..21060122 287..629 100 <- Minus
2R 21060180..21060465 1..286 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:22 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21059780..21060122 287..629 100 <- Minus
2R 21060180..21060465 1..286 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:58:59 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16947285..16947627 287..629 100 <- Minus
arm_2R 16947685..16947970 1..286 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:05 Download gff for FI06445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21061379..21061664 1..286 100   Minus
2R 21060979..21061321 287..629 100 <- Minus

FI06445.pep Sequence

Translation from 0 to 509

> FI06445.pep
VGLKFPSNRTLGNICVYGAVASISAVMYMKWKMEDRVKSAEYYKLALKAL
RSHRGAVGLLGEPIKDSGIDLSNANNNCNAEEARCEVAVRGSKDKGTLYF
WASNQPDRGWLIDRLELETKLNPEKRFLLKKSEELTFDLPESITKQTAQQ
VDSNVILSASDQQPETHSK*

FI06445.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12986-PA 150 GF12986-PA 2..150 1..151 653 80.8 Plus
Dana\GF15580-PA 217 GF15580-PA 8..144 3..139 443 54.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20810-PA 170 GG20810-PA 2..170 1..169 770 94.7 Plus
Dere\GG25096-PA 216 GG25096-PA 8..186 3..167 458 45.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21370-PA 191 GH21370-PA 4..157 1..159 549 63.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15653-PA 170 CG15653-PA 2..170 1..169 872 100 Plus
CG31913-PA 215 CG31913-PA 11..165 6..166 441 51.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20566-PA 187 GI20566-PA 6..138 3..136 529 70.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10185-PA 191 GL10185-PA 3..164 2..165 606 69.3 Plus
Dper\GL19033-PA 209 GL19033-PA 8..117 3..132 372 53.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13872-PA 191 GA13872-PA 3..164 2..165 603 69.3 Plus
Dpse\GA16560-PA 229 GA16560-PA 8..136 3..131 458 61.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15757-PA 170 GM15757-PA 2..170 1..169 800 96.4 Plus
Dsec\GM18572-PA 215 GM18572-PA 8..185 3..167 460 47.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25231-PA 170 GD25231-PA 2..170 1..169 870 97 Plus
Dsim\GD23362-PA 215 GD23362-PA 8..185 3..167 461 47.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19912-PA 197 GJ19912-PA 6..137 3..134 554 72 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22946-PA 159 GK22946-PA 4..158 3..161 534 63.7 Plus
Dwil\GK15418-PA 255 GK15418-PA 6..140 1..135 450 57.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13750-PA 170 GE13750-PA 2..170 1..169 780 94.1 Plus
Dyak\GE25636-PA 214 GE25636-PA 8..136 3..131 443 58.1 Plus

FI06445.hyp Sequence

Translation from 1 to 509

> FI06445.hyp
VGLKFPSNRTLGNICVYGAVASISAVMYMKWKMEDRVKSAEYYKLALKAL
RSHRGAVGLLGEPIKDSGIDLSNANNNCNAEEARCEVAVRGSKDKGTLYF
WASNQPDRGWLIDRLELETKLNPEKRFLLKKSEELTFDLPESITKQTAQQ
VDSNVILSASDQQPETHSK*

FI06445.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15653-PA 170 CG15653-PA 2..170 1..169 872 100 Plus
CG31913-PA 215 CG31913-PA 11..165 6..166 441 51.6 Plus