Clone FI06447 Report

Search the DGRC for FI06447

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:47
Vector:pOT2
Associated Gene/TranscriptCG31427-RB
Protein status:FI06447.pep: Imported from assembly
Sequenced Size:1101

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31427 2008-12-18 5.12 accounting

Clone Sequence Records

FI06447.complete Sequence

1101 bp assembled on 2008-10-24

GenBank Submission: BT050489.1

> FI06447.complete
TTCAGATGTACTATCAAGTATTCTCGGAGTACTCCTAGATTAAATCGTAG
TTTTGGGAAACAAAAGTCAGCGATTAAATCACAAAGACATTGAACCCAGT
ATGAAGTGGCTTGTGTTATTTGTAATAACCCTTGGCTTAGGATTAGCCAC
ACCCAATTCGACCTACAATCATTATCGCCTGCCGACGGCACTTCGACCTA
TCAAGTATGACCTGCACGTGCTAACCCAGCTGGAATATGCTGATGATTTT
AGTTTTAACGGAAGTGTGAAAATCCAAATCCAAGTCTTGGAAAACACCAA
CAACATAACTTTGCATTCGAAGGAACTGACGATCGATGAGACGGCAACCA
CTCTTCGCCAAATTACCGGAGAGGATCTAAAGAATAACTGCGTGTCCTCC
ACAGAGACCGATTGCGGGGATACTACCGCAGCTCCTACGTGGATCCTGTG
GCCAATGAGACCAGGTGTGGACTGGCGATTACTCGAAGAAGAAAACAGAT
ATTTAATCCTTGTATGTTCACCGGACTTAGCAATATGCCCGTGAAGCATA
CCGGCAAAGATGATTTCCTTCCCGATTACGTATGGACCGAGTTCCAGGAG
TCGTTGCCAATCTCCACCTACCTGGTCGCCTATTCCGTGAATGATGCCAA
GGAAGGTATTCGCAAGGGGGATTCGAAGTGGGCCTTCCAGGCGGTGGCCA
AAACGGAGGTCGGGTTCCACAACAACAACATTGGGTCTATAAGTGATTAG
TAAGTAAAAGGAGGTTTGAGTTTGATATCTATACATTCAATATTTTTCTT
TGAGCTATAATCAGCTAATGAAAAGCATCCCTCTACTTCTGGAACCCTTT
CAAAGGCAGATTTATACCCGGAAGGACTACTATGAGTTCAAGCTATTTTT
GGCCGATTCCCAGGAGTTCCTTTGGAGATAATACTGACCAATGTGCAGTG
GCAGGAGCGAAACTATGATAAGTTGACCCGGACAATCAAACATTTCCTGT
AGACTTTCTACAGTTAGTAAACAACTAAACCGCAAATTAAATACCTCTTA
TAATGCTTAATAAATAGGAAATTGTAAAAAATAAAAAAAAAAAAAAAAAA
A

FI06447.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG31427-RB 1084 CG31427-RB 1..1084 1..1084 5420 100 Plus
CG31427-RC 1192 CG31427-RC 513..1192 405..1084 3400 100 Plus
CG31427-RC 1192 CG31427-RC 9..414 1..406 2030 100 Plus
SP1029.c 3116 SP1029.c 688..761 572..645 220 86.4 Plus
SP1029.c 3116 SP1029.c 2485..2537 647..699 145 84.9 Plus
SP1029.c 3116 SP1029.c 2755..2797 923..965 140 88.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25061599..25062120 1082..561 2610 100 Minus
chr3R 27901430 chr3R 25062431..25062745 406..92 1530 99 Minus
chr3R 27901430 chr3R 25062177..25062332 560..405 780 100 Minus
chr3R 27901430 chr3R 25062983..25063074 93..2 460 100 Minus
chr3R 27901430 chr3R 25060623..25060764 372..231 305 81 Minus
chr3R 27901430 chr3R 25070340..25070413 645..572 220 86.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29238828..29239351 1084..561 2620 100 Minus
3R 32079331 3R 29239662..29239976 406..92 1575 100 Minus
3R 32079331 3R 29239408..29239563 560..405 780 100 Minus
3R 32079331 3R 29240217..29240308 92..1 460 100 Minus
3R 32079331 3R 29237857..29237998 372..231 290 80.3 Minus
3R 32079331 3R 29247557..29247630 645..572 220 86.5 Minus
3R 32079331 3R 29243010..29243078 645..577 195 85.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28979659..28980182 1084..561 2620 100 Minus
3R 31820162 3R 28980493..28980807 406..92 1575 100 Minus
3R 31820162 3R 28980239..28980394 560..405 780 100 Minus
3R 31820162 3R 28981048..28981139 92..1 460 100 Minus
3R 31820162 3R 28978688..28978829 372..231 290 80.2 Minus
3R 31820162 3R 28988388..28988461 645..572 220 86.4 Minus
3R 31820162 3R 28983841..28983909 645..577 195 85.5 Minus
3R 31820162 3R 28976229..28976276 968..921 165 89.5 Minus
3R 31820162 3R 28986282..28986334 699..647 145 84.9 Minus
3R 31820162 3R 28985958..28986000 965..923 140 88.3 Minus
Blast to na_te.dros performed on 2019-03-16 18:04:12 has no hits.

FI06447.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:04:50 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25061599..25062120 561..1082 100 <- Minus
chr3R 25062177..25062330 407..560 100 <- Minus
chr3R 25062431..25062744 93..406 99 <- Minus
chr3R 25062984..25063074 1..92 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:26 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RB 1..444 101..544 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:16:25 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RD 407..750 407..750 100   Plus
CG31427-RD 1..306 101..406 100 -> Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:58 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RC 1..306 101..406 100 -> Plus
CG31427-RC 407..750 407..750 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:29:17 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RC 1..306 101..406 100 -> Plus
CG31427-RC 407..750 407..750 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:56 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RB 1..1082 1..1082 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:16:25 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RD 63..376 93..406 100 -> Plus
CG31427-RD 477..1152 407..1082 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:58 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RC 1..406 1..406 100 -> Plus
CG31427-RC 507..1182 407..1082 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-24 12:33:07 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RB 1..1082 1..1082 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:29:17 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG31427-RC 1..406 1..406 100 -> Plus
CG31427-RC 507..1182 407..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:50 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29238830..29239351 561..1082 100 <- Minus
3R 29239408..29239561 407..560 100 <- Minus
3R 29239662..29239975 93..406 100 <- Minus
3R 29240217..29240308 1..92 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:50 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29238830..29239351 561..1082 100 <- Minus
3R 29239408..29239561 407..560 100 <- Minus
3R 29239662..29239975 93..406 100 <- Minus
3R 29240217..29240308 1..92 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:50 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29238830..29239351 561..1082 100 <- Minus
3R 29239408..29239561 407..560 100 <- Minus
3R 29239662..29239975 93..406 100 <- Minus
3R 29240217..29240308 1..92 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:58 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25064552..25065073 561..1082 100 <- Minus
arm_3R 25065130..25065283 407..560 100 <- Minus
arm_3R 25065384..25065697 93..406 100 <- Minus
arm_3R 25065939..25066030 1..92 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:47:22 Download gff for FI06447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28979661..28980182 561..1082 100 <- Minus
3R 28980239..28980392 407..560 100 <- Minus
3R 28980493..28980806 93..406 100 <- Minus
3R 28981048..28981139 1..92 100   Minus

FI06447.pep Sequence

Translation from 100 to 543

> FI06447.pep
MKWLVLFVITLGLGLATPNSTYNHYRLPTALRPIKYDLHVLTQLEYADDF
SFNGSVKIQIQVLENTNNITLHSKELTIDETATTLRQITGEDLKNNCVSS
TETDCGDTTAAPTWILWPMRPGVDWRLLEEENRYLILVCSPDLAICP*

FI06447.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22895-PA 926 GF22895-PA 1..105 1..104 329 63.2 Plus
Dana\GF22898-PA 931 GF22898-PA 1..103 1..104 303 57.7 Plus
Dana\GF18836-PA 845 GF18836-PA 1..104 1..105 298 55.2 Plus
Dana\GF22897-PA 924 GF22897-PA 1..104 1..105 292 53.3 Plus
Dana\GF22899-PA 858 GF22899-PA 1..105 1..104 265 51.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12024-PA 833 GG12024-PA 1..104 1..104 425 77.9 Plus
Dere\GG12022-PA 937 GG12022-PA 1..116 1..104 330 59.5 Plus
Dere\GG12025-PA 931 GG12025-PA 1..104 1..104 317 58.7 Plus
Dere\GG12023-PA 926 GG12023-PA 1..106 1..104 296 58.5 Plus
Dere\GG20044-PA 908 GG20044-PA 10..85 9..85 150 42.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14003-PA 928 GH14003-PA 1..104 1..104 261 53.3 Plus
Dgri\GH23044-PA 909 GH23044-PA 21..97 22..100 185 50.6 Plus
Dgri\GH16839-PA 921 GH16839-PA 1..86 1..88 171 42.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
SP1029-PE 932 CG11956-PE 1..108 1..101 332 63.9 Plus
SP1029-PD 932 CG11956-PD 1..108 1..101 332 63.9 Plus
SP1029-PA 932 CG11956-PA 1..108 1..101 332 63.9 Plus
SP1029-PB 932 CG11956-PB 1..108 1..101 332 63.9 Plus
SP1029-PC 932 CG11956-PC 1..108 1..101 332 63.9 Plus
CG11951-PD 493 CG11951-PD 1..101 1..101 328 62.4 Plus
CG31445-PB 927 CG31445-PB 1..106 1..104 309 59.4 Plus
CG31445-PA 927 CG31445-PA 1..106 1..104 309 59.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22347-PA 930 GI22347-PA 1..105 1..105 268 53.8 Plus
Dmoj\GI21113-PA 904 GI21113-PA 9..84 13..85 185 52.6 Plus
Dmoj\GI22438-PA 811 GI22438-PA 16..70 19..73 142 41.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13602-PA 927 GL13602-PA 1..106 1..104 297 55.7 Plus
Dper\GL11277-PA 913 GL11277-PA 21..103 20..107 174 42 Plus
Dper\GL21166-PA 899 GL21166-PA 7..81 4..81 158 42 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26842-PA 927 GA26842-PA 1..106 1..104 297 55.7 Plus
Dpse\GA17486-PA 975 GA17486-PA 21..85 20..85 173 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12250-PA 307 GM12250-PA 1..104 1..104 451 84.6 Plus
Dsec\GM12248-PA 928 GM12248-PA 1..107 1..104 336 64.5 Plus
Dsec\GM12249-PA 927 GM12249-PA 1..106 1..104 307 58.5 Plus
Dsec\GM15558-PA 912 GM15558-PA 23..92 20..92 142 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17873-PA 924 GD17873-PA 1..104 1..104 464 86.5 Plus
Dsim\GD17853-PA 932 GD17853-PA 1..111 1..104 331 62.2 Plus
Dsim\GD17884-PA 808 GD17884-PA 1..100 1..101 312 61.4 Plus
Dsim\GD17862-PA 927 GD17862-PA 1..106 1..104 302 59.4 Plus
Dsim\GD25060-PA 912 GD25060-PA 23..92 20..92 145 43.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14226-PA 927 GJ14226-PA 14..102 13..102 254 58.9 Plus
Dvir\GJ20962-PA 910 GJ20962-PA 19..91 20..92 201 53.4 Plus
Dvir\GJ11001-PA 930 GJ11001-PA 17..70 20..73 145 44.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22491-PA 927 GK22491-PA 24..106 20..104 222 55.3 Plus
Dwil\GK19579-PA 889 GK19579-PA 8..119 5..116 147 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10462-PA 924 GE10462-PA 1..107 1..107 412 72.9 Plus
Dyak\GE10463-PA 924 GE10463-PA 1..104 1..104 342 63.5 Plus
Dyak\GE10459-PA 937 GE10459-PA 1..116 1..104 331 60.3 Plus
Dyak\GE10460-PA 935 GE10460-PA 14..114 3..104 300 62.7 Plus
Dyak\GE10461-PA 873 GE10461-PA 1..106 1..105 261 50 Plus

FI06447.hyp Sequence

Translation from 100 to 543

> FI06447.hyp
MKWLVLFVITLGLGLATPNSTYNHYRLPTALRPIKYDLHVLTQLEYADDF
SFNGSVKIQIQVLENTNNITLHSKELTIDETATTLRQITGEDLKNNCVSS
TETDCGDTTAAPTWILWPMRPGVDWRLLEEENRYLILVCSPDLAICP*

FI06447.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG31427-PE 249 CG31427-PE 1..104 1..104 526 98.1 Plus
CG31427-PD 249 CG31427-PD 1..104 1..104 526 98.1 Plus
CG31427-PC 249 CG31427-PC 1..104 1..104 526 98.1 Plus
CG31427-PF 291 CG31427-PF 1..104 1..104 526 98.1 Plus
CG11951-PB 493 CG11951-PB 1..101 1..101 328 62.4 Plus