Clone FI06454 Report

Search the DGRC for FI06454

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:54
Vector:pOT2
Associated Gene/TranscriptCG12516-RB
Protein status:FI06454.pep: gold
Sequenced Size:992

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12516 2008-12-18 5.12 accounting

Clone Sequence Records

FI06454.complete Sequence

992 bp assembled on 2008-10-23

GenBank Submission: BT050492.1

> FI06454.complete
AAATTATCAATATAGCTATTTAAATTATAGCTGGCATAATGATCAGCCCG
GTAATAACTCGACAAATGGTGCAAATCCTGCCAAGTGTTATGGTCGGTAG
GATAACACTTCCCGATATTATTGAGGATGCAATCAAGCCCCCAACGGAAG
ATATTAATTTCGAAGAAAAATCGAATGAGAATGAGGTGGAAGATAATACA
GAGAAATCGGAAGCGGTTTCTGAATCCGAAAAAGAGGTAATTGAGGTATC
TGAGGAGCCGAAGGAAGAAGAGGTAAAGTACGCTTGGAATGCACCCTGCA
TGATGGTCATCTTCGAGGATGGCGATGTCAATTGTGCCCTGCATCACCTG
GTCGAATCTCTACAGGATCCCTTTGCCTTAGATGCGGTTGCCGTGATCTT
GGTACAAGAAGCTTTAGCCGAAGAAATCGAAAACCGAGTAAAAATTCTGA
TGAAACCCTTGGATGCCAGGGTGGCCAATCATCCGTGCTACAAGCGCACT
CTGATGAAGATTGACGAACTTAGGCCGAAAACTATAATAGGTCCTTCAGA
TCGTGTCTTACCCGATGCCACGCCCATAATGGTGCGGGACATACCACACA
AATTTCTGGGCGATGGACCCACTGGCATTATAACCATGCATATTTTTCGC
ACCCCTTTCGAAGCCACTCAGATATATAGAAAGGAATATCCCCTACCAAT
CGCATCGGTTAGTATATGGAATGAGCGGGTTTCGAGTGTTTACGATGTAA
TTGGCATGATGAATCTACTCGATACCTTTAAGATCAACTGTTTCACGGTC
GATATGGAGCCCATTAAGCGGGCATTCGAGCTAAGGAAGTATAGTGCTTG
TATACATCGTGGTTATCACTATGAAACCCTGCCCATAAATGGCGAGAGAA
AGATTATCATATATCCAGTTGGAACTATATTTGGCAATTGAAGTGTAAGC
TGGGTAAATACAATACCATTATTCGAAAAAAAAAAAAAAAAA

FI06454.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG12516-RB 975 CG12516-RB 1..975 1..975 4875 100 Plus
CG12516.a 1202 CG12516.a 64..1017 1..954 4770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24126563..24127537 975..1 4860 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28303629..28304605 977..1 4885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28044460..28045436 977..1 4885 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:50:28 has no hits.

FI06454.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:52:00 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24126563..24127537 1..975 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:33 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RA 1..876 66..941 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:58 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RB 1..903 39..941 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:23:08 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RB 1..903 39..941 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:18:57 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RB 1..903 39..941 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:22 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RA 1..876 66..941 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:57 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RB 1..975 1..975 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:23:08 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RB 1..975 1..975 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-23 18:44:15 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RA 1..876 66..941 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:18:57 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12516-RB 1..975 1..975 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:52:00 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28303631..28304605 1..975 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:52:00 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28303631..28304605 1..975 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:52:00 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28303631..28304605 1..975 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:23:08 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24129353..24130327 1..975 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:52 Download gff for FI06454.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28044462..28045436 1..975 100   Minus

FI06454.pep Sequence

Translation from 38 to 940

> FI06454.pep
MISPVITRQMVQILPSVMVGRITLPDIIEDAIKPPTEDINFEEKSNENEV
EDNTEKSEAVSESEKEVIEVSEEPKEEEVKYAWNAPCMMVIFEDGDVNCA
LHHLVESLQDPFALDAVAVILVQEALAEEIENRVKILMKPLDARVANHPC
YKRTLMKIDELRPKTIIGPSDRVLPDATPIMVRDIPHKFLGDGPTGIITM
HIFRTPFEATQIYRKEYPLPIASVSIWNERVSSVYDVIGMMNLLDTFKIN
CFTVDMEPIKRAFELRKYSACIHRGYHYETLPINGERKIIIYPVGTIFGN
*

FI06454.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16130-PA 294 GF16130-PA 46..294 51..300 922 67.3 Plus
Dana\GF18368-PA 320 GF18368-PA 95..312 80..299 528 44.1 Plus
Dana\GF21319-PA 253 GF21319-PA 41..253 85..300 479 39.6 Plus
Dana\GF21501-PA 310 GF21501-PA 48..288 53..295 304 31.2 Plus
Dana\GF19861-PA 253 GF19861-PA 34..252 83..294 261 27.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12073-PA 291 GG12073-PA 1..291 10..300 1261 84.2 Plus
Dere\GG13512-PA 316 GG13512-PA 46..306 48..299 572 43 Plus
Dere\GG17756-PA 256 GG17756-PA 43..256 83..300 502 40.8 Plus
Dere\GG21350-PA 296 GG21350-PA 46..273 64..297 417 39.1 Plus
Dere\GG18907-PA 291 GG18907-PA 17..243 77..298 276 27.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12691-PA 274 GH12691-PA 27..274 52..300 558 45.2 Plus
Dgri\GH17535-PA 306 GH17535-PA 78..284 85..296 431 40.9 Plus
Dgri\GH10452-PA 306 GH10452-PA 78..284 85..296 431 40.9 Plus
Dgri\GH19385-PA 273 GH19385-PA 3..251 49..298 350 30.7 Plus
Dgri\GH24176-PA 272 GH24176-PA 57..268 83..294 304 31.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG12516-PB 300 CG12516-PB 1..300 1..300 1558 100 Plus
CG2336-PA 322 CG2336-PA 45..311 30..298 559 41.3 Plus
CG15717-PE 252 CG15717-PE 22..252 73..300 500 41.3 Plus
CG15717-PC 252 CG15717-PC 22..252 73..300 500 41.3 Plus
CG15717-PA 252 CG15717-PA 22..252 73..300 500 41.3 Plus
CG11634-PB 298 CG11634-PB 17..276 35..295 394 35.5 Plus
CG11634-PA 298 CG11634-PA 17..276 35..295 394 35.5 Plus
CG13539-PB 260 CG13539-PB 37..256 82..294 254 27 Plus
CG13539-PA 260 CG13539-PA 37..256 82..294 254 27 Plus
CG5623-PA 279 CG5623-PA 35..250 82..296 254 30.7 Plus
CG12637-PA 292 CG12637-PA 17..238 77..293 246 25.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16366-PA 282 GI16366-PA 64..282 80..300 515 46.2 Plus
Dmoj\GI17704-PA 335 GI17704-PA 98..313 79..296 373 36.5 Plus
Dmoj\GI15524-PA 271 GI15524-PA 49..266 76..294 304 30.4 Plus
Dmoj\GI22587-PA 272 GI22587-PA 31..252 78..300 302 30.8 Plus
Dmoj\GI14293-PA 252 GI14293-PA 22..237 83..293 250 26.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23868-PA 301 GL23868-PA 2..301 10..300 865 55.6 Plus
Dper\GL21758-PA 320 GL21758-PA 77..302 71..300 579 46.5 Plus
Dper\GL14951-PA 265 GL14951-PA 47..265 82..300 544 46.6 Plus
Dper\GL25661-PA 286 GL25661-PA 8..261 38..294 307 30.3 Plus
Dper\GL21165-PA 280 GL21165-PA 56..274 83..294 269 28.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11672-PA 301 GA11672-PA 2..301 10..300 851 54.6 Plus
Dpse\GA26390-PA 320 GA26390-PA 77..302 71..300 579 46.5 Plus
Dpse\GA13910-PA 265 GA13910-PA 47..265 82..300 537 46.6 Plus
Dpse\GA11111-PA 322 GA11111-PA 44..297 38..294 310 30.3 Plus
Dpse\GA27755-PA 322 GA27755-PA 44..297 38..294 300 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16298-PA 291 GM16298-PA 1..291 10..300 1392 94.5 Plus
Dsec\GM10901-PA 319 GM10901-PA 83..309 72..299 554 44.1 Plus
Dsec\GM11602-PA 252 GM11602-PA 22..252 73..300 507 40 Plus
Dsec\GM16149-PA 298 GM16149-PA 46..276 64..295 396 38.6 Plus
Dsec\GM11293-PA 292 GM11293-PA 17..238 77..293 270 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18037-PA 300 GD18037-PA 1..300 1..300 1440 95 Plus
Dsim\GD19880-PA 321 GD19880-PA 85..311 72..299 569 45.4 Plus
Dsim\GD17100-PA 252 GD17100-PA 22..252 73..300 501 40.3 Plus
Dsim\GD24338-PA 298 GD24338-PA 46..276 64..295 392 38.6 Plus
Dsim\GD16020-PA 292 GD16020-PA 17..238 77..293 263 26.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16736-PA 280 GJ16736-PA 50..280 70..300 618 49.4 Plus
Dvir\GJ13210-PA 254 GJ13210-PA 3..252 47..298 544 43.7 Plus
Dvir\GJ11430-PA 333 GJ11430-PA 101..311 85..296 387 38 Plus
Dvir\GJ10307-PA 272 GJ10307-PA 19..250 71..298 312 31.2 Plus
Dvir\GJ14727-PA 272 GJ14727-PA 50..268 76..294 300 31.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24553-PA 296 GK24553-PA 10..296 2..300 630 43.5 Plus
Dwil\GK11577-PA 271 GK11577-PA 30..268 60..298 581 43.8 Plus
Dwil\GK17389-PA 299 GK17389-PA 83..299 83..300 523 42 Plus
Dwil\GK18716-PA 274 GK18716-PA 15..250 58..294 426 36.8 Plus
Dwil\GK11680-PA 275 GK11680-PA 36..246 83..293 286 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10517-PA 273 GE10517-PA 1..273 1..300 1123 76.7 Plus
Dyak\GE10227-PA 323 GE10227-PA 89..315 72..299 560 45 Plus
Dyak\GE17046-PA 253 GE17046-PA 3..253 45..300 519 38.9 Plus
Dyak\GE12931-PA 297 GE12931-PA 23..277 46..297 401 37 Plus
Dyak\GE15381-PA 269 GE15381-PA 17..243 77..298 276 26.6 Plus

FI06454.hyp Sequence

Translation from 38 to 940

> FI06454.hyp
MISPVITRQMVQILPSVMVGRITLPDIIEDAIKPPTEDINFEEKSNENEV
EDNTEKSEAVSESEKEVIEVSEEPKEEEVKYAWNAPCMMVIFEDGDVNCA
LHHLVESLQDPFALDAVAVILVQEALAEEIENRVKILMKPLDARVANHPC
YKRTLMKIDELRPKTIIGPSDRVLPDATPIMVRDIPHKFLGDGPTGIITM
HIFRTPFEATQIYRKEYPLPIASVSIWNERVSSVYDVIGMMNLLDTFKIN
CFTVDMEPIKRAFELRKYSACIHRGYHYETLPINGERKIIIYPVGTIFGN
*

FI06454.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12516-PB 300 CG12516-PB 1..300 1..300 1558 100 Plus
CG2336-PA 322 CG2336-PA 45..311 30..298 559 41.3 Plus
CG15717-PE 252 CG15717-PE 22..252 73..300 500 41.3 Plus
CG15717-PC 252 CG15717-PC 22..252 73..300 500 41.3 Plus
CG15717-PA 252 CG15717-PA 22..252 73..300 500 41.3 Plus