Clone FI06457 Report

Search the DGRC for FI06457

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:57
Vector:pOT2
Associated Gene/TranscriptCG17982-RA
Protein status:FI06457.pep: gold
Sequenced Size:1005

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17982 2008-12-18 5.12 accounting

Clone Sequence Records

FI06457.complete Sequence

1005 bp assembled on 2008-10-24

GenBank Submission: BT050493.1

> FI06457.complete
GTTTGGGCCTTGAAAAATGGCAAGCAATCCGAAGAAGTCCCTCCACCAGG
CGATCCAGGCCGAGTTTGGTCTCCAGCCCACCAGCGATTTGTCCAAATTG
AGCAGTATAAGTGGCACGAGCCCAGAAGCGATGCCAAAATTCACAATTCC
GCAGCTCAAAATTCCACAGCTTAGAATTCCACAATTGCAGCTGCAGACGA
ATGCGGATGCCGCTGCCGAGCAGGAATACCGCCGAGAGGCGGAGGCACAC
AATCAAATGCTACTCAATGAGATCCAGTTGAGGCAACGGCAGCGATCGGA
GGGCGAAAACAAGCCGCAATCAATGGGATTTGTGTTACCCCAACTGGTCG
CGATGCCCAAGGAGCCCCTGAACATACCCCTGCTGACAAGGTTGGAGAGC
GGCATGAAGAAGCTGGATATAGGCGATGGGACAAAGGTGAATACAGCCAC
GTCAGCACCCCCACTCATTGACCTCACGTCCACGATTATCGCCAGGCATA
AAGGCGCACCGCCCAAGGAGCTGGCCAGCAAGGCGCGCCAGTTGACCAAT
TGTGAGCCTTTTGCCATACCCTTCATTGCCTGCGATCGCGGAAGAAGGAG
CACGACCGGTGTAACTCTCTTGGCCAGCAAAAGATCCATCAACTACGACG
AGGACGTGCTGGCCGATCGGTCACCAGCGAATAGCGACTACCGGGAGCAA
CCGGGACCCATTGGGCTCATGCTGGACGAAATGGTGGGCTATCCGGAGCC
GAGAAAGCCCCGTCTAGTGTACGCCGTCACTCCGCTGGAACGGCAGCACC
TGCGAATGTGCCAGTATAAGGATTACGGCATCCAGGTGAAGAGATTCCGC
TTTGATACTCCCTCGCCGGATGAGCTCGTCAAGCAGGCGCTGCAGAAGTC
CTGGCGCTTCTCCCGCACTTGACTCCAGTTCATCCTGGTAGTTGACAATT
ACCAATAAGTGAATAAAAACAAAAAATCCACTACGTTCAAAAAAAAAAAA
AAAAA

FI06457.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG17982-RA 906 CG17982-RA 1..906 17..922 4530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8034386..8035373 988..1 4940 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8142540..8143537 998..1 4975 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8150638..8151635 998..1 4975 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 21:04:51 has no hits.

FI06457.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:05:31 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8034386..8035373 1..988 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:34 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 1..906 17..922 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:16:17 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 1..906 17..922 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:37:00 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 1..906 17..922 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:42:56 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 1..906 17..922 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:58 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 1..906 17..922 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:16:16 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 69..1056 1..988 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:37:00 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 69..1056 1..988 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-24 12:35:32 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 1..906 17..922 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:56 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
CG17982-RA 69..1056 1..988 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:05:31 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
X 8142550..8143537 1..988 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:05:31 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
X 8142550..8143537 1..988 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:05:31 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
X 8142550..8143537 1..988 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:37:00 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8036583..8037570 1..988 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:47:14 Download gff for FI06457.complete
Subject Subject Range Query Range Percent Splice Strand
X 8150648..8151635 1..988 100   Minus

FI06457.pep Sequence

Translation from 16 to 921

> FI06457.pep
MASNPKKSLHQAIQAEFGLQPTSDLSKLSSISGTSPEAMPKFTIPQLKIP
QLRIPQLQLQTNADAAAEQEYRREAEAHNQMLLNEIQLRQRQRSEGENKP
QSMGFVLPQLVAMPKEPLNIPLLTRLESGMKKLDIGDGTKVNTATSAPPL
IDLTSTIIARHKGAPPKELASKARQLTNCEPFAIPFIACDRGRRSTTGVT
LLASKRSINYDEDVLADRSPANSDYREQPGPIGLMLDEMVGYPEPRKPRL
VYAVTPLERQHLRMCQYKDYGIQVKRFRFDTPSPDELVKQALQKSWRFSR
T*

FI06457.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21307-PA 304 GF21307-PA 1..304 1..301 658 49.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17984-PA 290 GG17984-PA 1..290 1..301 1055 74.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24863-PA 283 GH24863-PA 24..283 27..301 340 35.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17982-PB 301 CG17982-PB 1..301 1..301 1545 100 Plus
CG17982-PA 301 CG17982-PA 1..301 1..301 1545 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14414-PA 319 GI14414-PA 14..319 7..301 459 40.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20192-PA 295 GL20192-PA 1..295 1..301 567 46.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14753-PA 312 GA14753-PA 1..312 1..301 562 45.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11207-PA 298 GM11207-PA 1..298 1..301 1389 88.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24641-PA 298 GD24641-PA 1..298 1..301 1394 88.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18761-PA 343 GJ18761-PA 14..343 7..301 524 41.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10132-PA 308 GK10132-PA 19..308 8..301 381 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17478-PA 305 GE17478-PA 1..305 1..301 1168 74.5 Plus

FI06457.hyp Sequence

Translation from 16 to 921

> FI06457.hyp
MASNPKKSLHQAIQAEFGLQPTSDLSKLSSISGTSPEAMPKFTIPQLKIP
QLRIPQLQLQTNADAAAEQEYRREAEAHNQMLLNEIQLRQRQRSEGENKP
QSMGFVLPQLVAMPKEPLNIPLLTRLESGMKKLDIGDGTKVNTATSAPPL
IDLTSTIIARHKGAPPKELASKARQLTNCEPFAIPFIACDRGRRSTTGVT
LLASKRSINYDEDVLADRSPANSDYREQPGPIGLMLDEMVGYPEPRKPRL
VYAVTPLERQHLRMCQYKDYGIQVKRFRFDTPSPDELVKQALQKSWRFSR
T*

FI06457.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG17982-PB 301 CG17982-PB 1..301 1..301 1545 100 Plus
CG17982-PA 301 CG17982-PA 1..301 1..301 1545 100 Plus