BDGP Sequence Production Resources |
Search the DGRC for FI06460
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 64 |
Well: | 60 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpS18A-RA |
Protein status: | FI06460.pep: gold |
Sequenced Size: | 587 |
Gene | Date | Evidence |
---|---|---|
mRpS18A | 2008-08-15 | Release 5.9 accounting |
mRpS18A | 2008-12-18 | 5.12 accounting |
587 bp assembled on 2008-07-25
GenBank Submission: BT032661
> FI06460.complete TGACATTTGTAGTAACAACATTACACTTGAGCACAATTTTAATAAATTGT AAATAAAAAACGCCTTCAACATGTCCTTTGTGTTGCAATTGGCCACCAGG ACAGTACGAAGTACCATTGCTCAGGTGCGTGGCGTAGCCACCACAATGCC AAGGCAAATTAAAGAGATTCATGAGAAGCAGGAGAACAGTGTAAAGATCT TCGAGGGCGTTAATGTGGAATCGCCGCGTGCTCACCTGATGCTTAAATCC GCCTGCCAGACCAAGTTTTGCCCGGAATGCACCTTGGGCCTGGACATCAA GCACACGGATGTGCTAATCCTGTCGCAGTATGTCCGTTCCGACGGCTGTA TGCTGCCCAGAAGGATCACCGGACTTTGCCACCGGCAACAAAAGAAGATG GGCACTCTGGTAACCATGGCTCAGAAGGCGGGACTGATGCCAAATCTGGC GCCCGAGTGGAGTAAAAGAGATCCCAAGAAGCGCTTCGGCTGGCGCAAGT TCAACAAGTACTTCCTGGAGTCCACAATTAAATACTAGTGTTAAATACAA TAAATGTTGTTAATAGAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS18A-RA | 636 | mRpS18A-RA | 25..594 | 1..570 | 2835 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 339..368 | 31..60 | 114 | 86.7 | Plus |
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 6925..6954 | 31..60 | 114 | 86.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 4387927..4388325 | 168..566 | 100 | <- | Minus |
chr3R | 4388422..4388588 | 1..167 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 1..468 | 71..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 1..468 | 71..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 1..468 | 71..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 1..468 | 71..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 1..468 | 71..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 6..571 | 1..566 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 6..571 | 1..566 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 16..581 | 1..566 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 6..571 | 1..566 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18A-RA | 16..581 | 1..566 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8561917..8562315 | 168..566 | 100 | <- | Minus |
3R | 8562412..8562578 | 1..167 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8561917..8562315 | 168..566 | 100 | <- | Minus |
3R | 8562412..8562578 | 1..167 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8561917..8562315 | 168..566 | 100 | <- | Minus |
3R | 8562412..8562578 | 1..167 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 4387639..4388037 | 168..566 | 100 | <- | Minus |
arm_3R | 4388134..4388300 | 1..167 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8302748..8303146 | 168..566 | 100 | <- | Minus |
3R | 8303243..8303409 | 1..167 | 99 | Minus |
Translation from 70 to 537
> FI06460.hyp MSFVLQLATRTVRSTIAQVRGVATTMPRQIKEIHEKQENSVKIFEGVNVE SPRAHLMLKSACQTKFCPECTLGLDIKHTDVLILSQYVRSDGCMLPRRIT GLCHRQQKKMGTLVTMAQKAGLMPNLAPEWSKRDPKKRFGWRKFNKYFLE STIKY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS18A-PA | 155 | CG31450-PA | 1..155 | 1..155 | 812 | 100 | Plus |
Translation from 70 to 537
> FI06460.pep MSFVLQLATRTVRSTIAQVRGVATTMPRQIKEIHEKQENSVKIFEGVNVE SPRAHLMLKSACQTKFCPECTLGLDIKHTDVLILSQYVRSDGCMLPRRIT GLCHRQQKKMGTLVTMAQKAGLMPNLAPEWSKRDPKKRFGWRKFNKYFLE STIKY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20702-PA | 154 | GF20702-PA | 1..154 | 1..155 | 699 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17441-PA | 155 | GG17441-PA | 1..155 | 1..155 | 766 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14680-PA | 155 | GH14680-PA | 1..155 | 1..155 | 653 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS18A-PA | 155 | CG31450-PA | 1..155 | 1..155 | 812 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23675-PA | 155 | GI23675-PA | 1..155 | 1..155 | 660 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21542-PA | 155 | GL21542-PA | 1..155 | 1..155 | 684 | 78.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16258-PA | 155 | GA16258-PA | 1..155 | 1..155 | 676 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26335-PA | 155 | GM26335-PA | 1..155 | 1..155 | 799 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20860-PA | 155 | GD20860-PA | 1..155 | 1..155 | 802 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23236-PA | 155 | GJ23236-PA | 1..155 | 1..155 | 665 | 78.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11511-PA | 155 | GK11511-PA | 1..155 | 1..155 | 656 | 77.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24843-PA | 155 | GE24843-PA | 1..155 | 1..155 | 787 | 94.2 | Plus |