Clone FI06460 Report

Search the DGRC for FI06460

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:60
Vector:pOT2
Associated Gene/TranscriptmRpS18A-RA
Protein status:FI06460.pep: gold
Sequenced Size:587

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpS18A 2008-08-15 Release 5.9 accounting
mRpS18A 2008-12-18 5.12 accounting

Clone Sequence Records

FI06460.complete Sequence

587 bp assembled on 2008-07-25

GenBank Submission: BT032661

> FI06460.complete
TGACATTTGTAGTAACAACATTACACTTGAGCACAATTTTAATAAATTGT
AAATAAAAAACGCCTTCAACATGTCCTTTGTGTTGCAATTGGCCACCAGG
ACAGTACGAAGTACCATTGCTCAGGTGCGTGGCGTAGCCACCACAATGCC
AAGGCAAATTAAAGAGATTCATGAGAAGCAGGAGAACAGTGTAAAGATCT
TCGAGGGCGTTAATGTGGAATCGCCGCGTGCTCACCTGATGCTTAAATCC
GCCTGCCAGACCAAGTTTTGCCCGGAATGCACCTTGGGCCTGGACATCAA
GCACACGGATGTGCTAATCCTGTCGCAGTATGTCCGTTCCGACGGCTGTA
TGCTGCCCAGAAGGATCACCGGACTTTGCCACCGGCAACAAAAGAAGATG
GGCACTCTGGTAACCATGGCTCAGAAGGCGGGACTGATGCCAAATCTGGC
GCCCGAGTGGAGTAAAAGAGATCCCAAGAAGCGCTTCGGCTGGCGCAAGT
TCAACAAGTACTTCCTGGAGTCCACAATTAAATACTAGTGTTAAATACAA
TAAATGTTGTTAATAGAAAAAAAAAAAAAAAAAAAAA

FI06460.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18A-RA 636 mRpS18A-RA 25..594 1..570 2835 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4387927..4388325 566..168 1995 100 Minus
chr3R 27901430 chr3R 4388422..4388588 167..1 820 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:16:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8561913..8562315 570..168 2015 100 Minus
3R 32079331 3R 8562412..8562578 167..1 820 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8302744..8303146 570..168 2015 100 Minus
3R 31820162 3R 8303243..8303409 167..1 820 99.4 Minus
Blast to na_te.dros performed 2019-03-16 16:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 339..368 31..60 114 86.7 Plus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 6925..6954 31..60 114 86.7 Plus

FI06460.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:55:45 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4387927..4388325 168..566 100 <- Minus
chr3R 4388422..4388588 1..167 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:37 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 1..468 71..538 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:40 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 1..468 71..538 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:17 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 1..468 71..538 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:38 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 1..468 71..538 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:47:03 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 1..468 71..538 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:58 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 6..571 1..566 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:40 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 6..571 1..566 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:17 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 16..581 1..566 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:08 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 6..571 1..566 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:47:03 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18A-RA 16..581 1..566 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:45 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8561917..8562315 168..566 100 <- Minus
3R 8562412..8562578 1..167 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:45 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8561917..8562315 168..566 100 <- Minus
3R 8562412..8562578 1..167 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:45 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8561917..8562315 168..566 100 <- Minus
3R 8562412..8562578 1..167 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:17 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4387639..4388037 168..566 100 <- Minus
arm_3R 4388134..4388300 1..167 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:30 Download gff for FI06460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8302748..8303146 168..566 100 <- Minus
3R 8303243..8303409 1..167 99   Minus

FI06460.hyp Sequence

Translation from 70 to 537

> FI06460.hyp
MSFVLQLATRTVRSTIAQVRGVATTMPRQIKEIHEKQENSVKIFEGVNVE
SPRAHLMLKSACQTKFCPECTLGLDIKHTDVLILSQYVRSDGCMLPRRIT
GLCHRQQKKMGTLVTMAQKAGLMPNLAPEWSKRDPKKRFGWRKFNKYFLE
STIKY*

FI06460.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18A-PA 155 CG31450-PA 1..155 1..155 812 100 Plus

FI06460.pep Sequence

Translation from 70 to 537

> FI06460.pep
MSFVLQLATRTVRSTIAQVRGVATTMPRQIKEIHEKQENSVKIFEGVNVE
SPRAHLMLKSACQTKFCPECTLGLDIKHTDVLILSQYVRSDGCMLPRRIT
GLCHRQQKKMGTLVTMAQKAGLMPNLAPEWSKRDPKKRFGWRKFNKYFLE
STIKY*

FI06460.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20702-PA 154 GF20702-PA 1..154 1..155 699 81.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17441-PA 155 GG17441-PA 1..155 1..155 766 91.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14680-PA 155 GH14680-PA 1..155 1..155 653 76.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18A-PA 155 CG31450-PA 1..155 1..155 812 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23675-PA 155 GI23675-PA 1..155 1..155 660 76.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21542-PA 155 GL21542-PA 1..155 1..155 684 78.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16258-PA 155 GA16258-PA 1..155 1..155 676 78.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26335-PA 155 GM26335-PA 1..155 1..155 799 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20860-PA 155 GD20860-PA 1..155 1..155 802 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23236-PA 155 GJ23236-PA 1..155 1..155 665 78.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11511-PA 155 GK11511-PA 1..155 1..155 656 77.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24843-PA 155 GE24843-PA 1..155 1..155 787 94.2 Plus