Clone FI06469 Report

Search the DGRC for FI06469

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:69
Vector:pOT2
Associated Gene/TranscriptCG3337-RA
Protein status:FI06469.pep: gold
Sequenced Size:712

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3337 2008-08-15 Release 5.9 accounting
CG3337 2008-12-18 5.12 accounting

Clone Sequence Records

FI06469.complete Sequence

712 bp assembled on 2008-07-29

GenBank Submission: BT044289.1

> FI06469.complete
ATTGAGGTAAACATGAATTTCTGATAATAGAAATGGAACTCCTCAACGAA
TCTGCTCCGAATCCGCTTGCCAAGACGCCGAAAAGTGGCATGTCCACGGG
CGGCAAGATCCTGATAGCAGCAACGGGCGGAGTAGGTATCGGTCTGTCGA
TTGTGTGCGCCTCCTTTGTGGCGCCTGCATTCCGGAGGATTTGCTTGCCT
TATGTGCCAGCGACGACCGAGCAAATACAGAACGTTCTCAGCTTCCTGCC
CAAGAATTCGGCCGGAAAACTGCTGGACATTGGATCCGGCGACGGACGGA
TTGTAGTGGCTGCGGCACAGCATTGTGGTGCTCTAAAAGCAGATGGCGTG
GAGCTAAACCCATGGCTGGTCTACTACTCGCGCCTGGCCGCGCTGCGTCA
CAGCGTTTCCAAACGGACGAGATTTTTTCGGCGAGATCTCTGGAAGTTCG
ATATAAAGGACTACAACTTCGTGGTCATTTTTGGGGTTGAGCAGATGATG
CAAGATCTAGAACACAAACTCATTGCTGAGTGTCCGCACAACACCAAGAT
TATCGCCTGCCGCTTTCCACTACCCAGCCTAGAGCACGTGAAGATTATAG
AGGACGGAGTAAACACCGTCTGGTTCTACGACCTGAACAAAAGCTAGCAA
AAGTTTTATTAAATTGGTATTTTTATTGTTTTTCTCAGTAAAAAAAAAAA
AAAAAAAAAAAA

FI06469.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG3337-RA 820 CG3337-RA 56..751 1..696 3465 99.8 Plus
CG5871.a 3407 CG5871.a 3365..3407 696..654 200 97.6 Minus
CG5871-RA 3447 CG5871-RA 3405..3447 696..654 200 97.6 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17046627..17047007 689..309 1905 100 Minus
chr3R 27901430 chr3R 17047069..17047377 309..1 1530 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21222808..21223195 696..309 1925 99.7 Minus
3R 32079331 3R 21223257..21223565 309..1 1545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20963639..20964026 696..309 1925 99.7 Minus
3R 31820162 3R 20964088..20964396 309..1 1545 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:18:48 has no hits.

FI06469.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:42 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17046627..17047006 310..689 100 <- Minus
chr3R 17047069..17047377 1..309 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:48 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 1..615 33..647 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:54 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 1..615 33..647 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:44:17 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 1..615 33..647 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:39 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 1..615 33..647 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:51 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 1..615 33..647 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:23 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 1..615 33..647 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:54 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 20..708 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:44:17 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 20..708 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:20:34 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 1..615 33..647 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:51 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
CG3337-RA 20..708 1..689 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:42 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21222815..21223194 310..689 100 <- Minus
3R 21223257..21223565 1..309 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:42 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21222815..21223194 310..689 100 <- Minus
3R 21223257..21223565 1..309 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:42 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21222815..21223194 310..689 100 <- Minus
3R 21223257..21223565 1..309 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:44:17 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17048537..17048916 310..689 100 <- Minus
arm_3R 17048979..17049287 1..309 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:19 Download gff for FI06469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20963646..20964025 310..689 100 <- Minus
3R 20964088..20964396 1..309 100   Minus

FI06469.hyp Sequence

Translation from 32 to 646

> FI06469.hyp
MELLNESAPNPLAKTPKSGMSTGGKILIAATGGVGIGLSIVCASFVAPAF
RRICLPYVPATTEQIQNVLSFLPKNSAGKLLDIGSGDGRIVVAAAQHCGA
LKADGVELNPWLVYYSRLAALRHSVSKRTRFFRRDLWKFDIKDYNFVVIF
GVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVKIIEDGVNTVWFYD
LNKS*

FI06469.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3337-PB 204 CG3337-PB 1..204 1..204 1065 100 Plus
CG3337-PA 204 CG3337-PA 1..204 1..204 1065 100 Plus

FI06469.pep Sequence

Translation from 32 to 646

> FI06469.pep
MELLNESAPNPLAKTPKSGMSTGGKILIAATGGVGIGLSIVCASFVAPAF
RRICLPYVPATTEQIQNVLSFLPKNSAGKLLDIGSGDGRIVVAAAQHCGA
LKADGVELNPWLVYYSRLAALRHSVSKRTRFFRRDLWKFDIKDYNFVVIF
GVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVKIIEDGVNTVWFYD
LNKS*

FI06469.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11659-PA 208 GF11659-PA 1..204 1..204 921 82.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14783-PA 204 GG14783-PA 1..204 1..204 1008 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18959-PA 204 GH18959-PA 1..201 1..204 858 81.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG3337-PB 204 CG3337-PB 1..204 1..204 1065 100 Plus
CG3337-PA 204 CG3337-PA 1..204 1..204 1065 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10840-PA 205 GI10840-PA 1..201 1..204 814 77.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27166-PA 212 GL27166-PA 1..204 1..204 919 81.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17387-PA 212 GA17387-PA 1..204 1..204 922 81.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15091-PA 204 GM15091-PA 1..204 1..204 1061 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19998-PA 204 GD19998-PA 1..204 1..204 1057 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14445-PA 199 GJ14445-PA 1..184 20..203 803 83.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12186-PA 206 GK12186-PA 1..203 1..203 823 78.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25006-PA 204 GE25006-PA 1..204 1..204 1005 92.2 Plus