Clone FI06472 Report

Search the DGRC for FI06472

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:72
Vector:pOT2
Associated Gene/TranscriptBro-RA
Protein status:FI06472.pep: gold
Sequenced Size:728

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Bro 2008-08-15 Release 5.9 accounting
Bro 2008-12-18 5.12 accounting

Clone Sequence Records

FI06472.complete Sequence

728 bp assembled on 2008-07-29

GenBank Submission: BT044290.1

> FI06472.complete
GACATGCATCATCACCAGAATCTCGGAGACGCGGCCGCCATGAATGGAAT
GATCCCGCCATACGAAGCCATGGCTATGTACGAGCAGCCCAAGCCCAGAT
TCATCTTCAAGATGCCCCGCGTGGTGCCTGACCAGAGGTCCAAGTTCGAT
AGCGACGAGCTCTTCCGCCGATTGAGTAGGGAGAGCGAGGTTCGCTACAC
AGGATACCGGGAACGTGCAATGGAGGAGCGCAGGATGCGGTTTGTCAACG
ACTGCCGCAAGGGCTATGCGGAGATATCGATGGTAGCTTCAGGAACTAAT
CTGCAGCTCTACTTCAACGCCAACCACAATCCGTACGCCCAGGAGCAGGA
TTGCGATTTCGAGCGGGAGCGGGGCAAAGTTCATTTGCGTTCTAGTTTCA
TCATGAACGGGGTGTGCGTCCGCTTCCGGGGCTGGGTGGATCTGGACCGA
CTGGATGGCGCTGCCTGCCTGGAGTTCGATGAACAACGAGCCCAGCAGGA
GGATGCTCAGCTGCAGGAGCAGATTCAAAGCTACAACCAGCGCATGGCTG
AGTCCAGGAGAATCTACCACACGCCCCAGACTCCACCCGAGGATCACCAT
CACAGAGGTGGGCCTGGTCTGCCTAGAGGACCAATGGGATGGTAGTGCTA
TATATTACCCTCATAGCTTTAAGTAACATCTAAGTAAATCAACAATAAAT
ATCTGAAACCCAAAAAAAAAAAAAAAAA

FI06472.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Bro-RA 745 Bro-RA 34..745 1..712 3560 100 Plus
Bgb-RA 1266 Bgb-RA 361..499 77..215 335 82.7 Plus
Bgb-RA 1266 Bgb-RA 684..826 400..542 190 75.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1647495..1648205 1..711 3525 99.7 Plus
chr3L 24539361 chr3L 1639643..1640108 77..542 395 72.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1647902..1648613 1..712 3560 100 Plus
3L 28110227 3L 1640047..1640512 77..542 425 72.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1647902..1648613 1..712 3560 100 Plus
3L 28103327 3L 1640047..1640185 77..215 335 82.7 Plus
3L 28103327 3L 1640370..1640512 400..542 190 75.5 Plus
Blast to na_te.dros performed on 2019-03-16 18:39:17 has no hits.

FI06472.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:40:23 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1647495..1648205 1..711 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:50 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 1..642 4..645 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:56 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 1..642 4..645 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:50 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 1..642 4..645 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:43 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 1..642 4..645 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:45:11 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 1..642 4..645 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:28 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 34..744 1..711 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:56 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 34..744 1..711 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:50 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 34..744 1..711 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:19:23 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 34..744 1..711 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:45:11 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
Bro-RA 34..744 1..711 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:23 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1647902..1648612 1..711 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:23 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1647902..1648612 1..711 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:40:23 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1647902..1648612 1..711 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:50 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1647902..1648612 1..711 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:22 Download gff for FI06472.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1647902..1648612 1..711 100   Plus

FI06472.hyp Sequence

Translation from 0 to 644

> FI06472.hyp
DMHHHQNLGDAAAMNGMIPPYEAMAMYEQPKPRFIFKMPRVVPDQRSKFD
SDELFRRLSRESEVRYTGYRERAMEERRMRFVNDCRKGYAEISMVASGTN
LQLYFNANHNPYAQEQDCDFERERGKVHLRSSFIMNGVCVRFRGWVDLDR
LDGAACLEFDEQRAQQEDAQLQEQIQSYNQRMAESRRIYHTPQTPPEDHH
HRGGPGLPRGPMGW*

FI06472.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Bro-PA 213 CG7960-PA 1..213 2..214 1159 100 Plus
Bgb-PA 213 CG7959-PA 5..198 12..203 684 65.1 Plus
Bgb-PB 253 CG7959-PB 5..198 12..203 684 65.1 Plus

FI06472.pep Sequence

Translation from 0 to 644

> FI06472.pep
DMHHHQNLGDAAAMNGMIPPYEAMAMYEQPKPRFIFKMPRVVPDQRSKFD
SDELFRRLSRESEVRYTGYRERAMEERRMRFVNDCRKGYAEISMVASGTN
LQLYFNANHNPYAQEQDCDFERERGKVHLRSSFIMNGVCVRFRGWVDLDR
LDGAACLEFDEQRAQQEDAQLQEQIQSYNQRMAESRRIYHTPQTPPEDHH
HRGGPGLPRGPMGW*

FI06472.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24821-PA 214 GF24821-PA 1..199 2..200 956 88.4 Plus
Dana\GF24819-PA 213 GF24819-PA 3..211 10..214 686 61.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14810-PA 213 GG14810-PA 1..213 2..214 1136 98.6 Plus
Dere\GG14808-PA 213 GG14808-PA 3..211 10..214 687 61.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15956-PA 211 GH15956-PA 1..193 2..198 842 80.9 Plus
Dgri\GH15954-PA 214 GH15954-PA 2..212 8..214 690 61.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Bro-PA 213 CG7960-PA 1..213 2..214 1159 100 Plus
Bgb-PA 213 CG7959-PA 5..198 12..203 684 65.1 Plus
Bgb-PB 253 CG7959-PB 5..198 12..203 684 65.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16609-PA 206 GI16609-PA 1..183 2..193 796 76.6 Plus
Dmoj\GI16606-PA 214 GI16606-PA 2..212 8..214 696 61.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11917-PA 213 GL11917-PA 1..201 2..202 933 85.6 Plus
Dper\GL20806-PA 213 GL20806-PA 3..211 10..214 685 61.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23814-PA 213 GA23814-PA 1..201 2..202 935 85.6 Plus
Dpse\GA20722-PA 213 GA20722-PA 3..211 10..214 685 61.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14432-PA 213 GM14432-PA 1..213 2..214 1142 98.6 Plus
Dsec\GM14430-PA 213 GM14430-PA 3..211 10..214 687 61.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13634-PA 213 GD13634-PA 1..213 2..214 1142 98.6 Plus
Dsim\GD17621-PA 213 GD17621-PA 3..211 10..214 687 61.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12863-PA 226 GJ12863-PA 12..207 1..198 893 81.3 Plus
Dvir\GJ12861-PA 214 GJ12861-PA 2..212 8..214 693 61.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24398-PA 204 GK24398-PA 1..204 2..214 827 72.6 Plus
Dwil\GK24387-PA 214 GK24387-PA 2..212 8..214 698 61.8 Plus
Dwil\GK23643-PA 214 GK23643-PA 2..177 8..184 691 70.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21173-PA 213 GE21173-PA 1..213 2..214 1142 99.1 Plus
Dyak\GE21171-PA 213 GE21171-PA 3..211 10..214 687 61.9 Plus