Clone FI06473 Report

Search the DGRC for FI06473

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:73
Vector:pOT2
Associated Gene/TranscriptDip2-RA
Protein status:FI06473.pep: gold
Sequenced Size:911

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Dip2 2008-08-15 Release 5.9 accounting
Dip2 2008-12-18 5.12 accounting

Clone Sequence Records

FI06473.complete Sequence

911 bp assembled on 2008-07-31

GenBank Submission: BT044291.1

> FI06473.complete
TTCGTAATTATTTAAATTTATTTAAAATGGCGACAAGGTCTTGTGCGTAC
AAGGACTGTGAATACTATTACGTAGGCCACGAAAACGCGCTGACCAAAGG
AAGAACCCTGTTTGCCTTTCCCAAACAACCGCAAAGGGCGAGAATCTGGC
ACGAAAACGGCCAAGTGCATCCAAAGATTCCCCATAGCCAGCTTTTTATG
TGCTCCCTTCACTTTGACCGCAAGTTCATATCCTCCTCTAAGAACCGAAC
GCTCCTCGTCGGCGAGGCAGTGCCGTTTCCGTACGAGGAAAGCAGTAGCA
AGCCGGAGGAGGAGCCCCAACAAGTGGCTTCCACTTCGCATGAGAGCTAC
TATATAAACCTGAGCGACGATGAGCTCAGCATCAACAATGTGGACACTAC
CTCAGTTACTACAATTGACGCAGTCCACGATAGTCCACCGCAGAAGCGCC
CGAAGGAATCTTCCATTGTCATTGCTCTAAAGGAAGCTGTGAAAATGGAA
CCCAATCCGAATGCAGGCCGAGTTAGAGCAGAACCCGACAATATAGATAC
TACTGAAGTGTCTGTGTTCAACTTCAAGGGACAGGAGTACGTACAAATGT
CTATGGAGTATTACTTGCAGGAAAAGCGGAAAATGGCTAAACTTTTGCAA
GACTATAAAAATGCTTTAAGAAGCATTAAGAAACATATTTCCCACCTTGA
CCTTTAACTTTATCAATGTAATACATGTTGTTCTTCTGTCAATTTACTGA
ACGTTATCTTAGCTTAAAAGCACCTGACGAATTGGGAAACAAACCTAATA
ATTTATTTTATTATACTTGGAGAATAAATACTGATAAATATTAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

FI06473.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dip2-RA 1027 Dip2-RA 65..908 1..844 4205 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 470359..470786 842..415 2140 100 Minus
chr3R 27901430 chr3R 470891..471304 414..1 2070 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4644647..4645076 844..415 2135 99.8 Minus
3R 32079331 3R 4645181..4645594 414..1 2070 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4385478..4385907 844..415 2135 99.7 Minus
3R 31820162 3R 4386012..4386425 414..1 2070 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:17:06 has no hits.

FI06473.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:18:08 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 470359..470786 415..842 100 <- Minus
chr3R 470891..471270 35..414 100 -> Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:52 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 1..681 27..707 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:16 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 1..681 27..707 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:50:55 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 1..681 27..707 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:27 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 1..681 27..707 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:57 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 1..681 27..707 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:50 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 1..842 1..842 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:15 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 1..842 1..842 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:55 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 62..903 1..842 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-31 11:07:08 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 1..842 1..842 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:57 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
Dip2-RA 62..903 1..842 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:08 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4644649..4645076 415..842 99 <- Minus
3R 4645181..4645594 1..414 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:08 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4644649..4645076 415..842 99 <- Minus
3R 4645181..4645594 1..414 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:08 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4644649..4645076 415..842 99 <- Minus
3R 4645181..4645594 1..414 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:55 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 470371..470798 415..842 99 <- Minus
arm_3R 470903..471316 1..414 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:15 Download gff for FI06473.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4385480..4385907 415..842 99 <- Minus
3R 4386012..4386425 1..414 100   Minus

FI06473.hyp Sequence

Translation from 2 to 706

> FI06473.hyp
RNYLNLFKMATRSCAYKDCEYYYVGHENALTKGRTLFAFPKQPQRARIWH
ENGQVHPKIPHSQLFMCSLHFDRKFISSSKNRTLLVGEAVPFPYEESSSK
PEEEPQQVASTSHESYYINLSDDELSINNVDTTSVTTIDAVHDSPPQKRP
KESSIVIALKEAVKMEPNPNAGRVRAEPDNIDTTEVSVFNFKGQEYVQMS
MEYYLQEKRKMAKLLQDYKNALRSIKKHISHLDL*

FI06473.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dip2-PA 226 CG9771-PA 1..226 9..234 1185 100 Plus

FI06473.pep Sequence

Translation from 2 to 706

> FI06473.pep
RNYLNLFKMATRSCAYKDCEYYYVGHENALTKGRTLFAFPKQPQRARIWH
ENGQVHPKIPHSQLFMCSLHFDRKFISSSKNRTLLVGEAVPFPYEESSSK
PEEEPQQVASTSHESYYINLSDDELSINNVDTTSVTTIDAVHDSPPQKRP
KESSIVIALKEAVKMEPNPNAGRVRAEPDNIDTTEVSVFNFKGQEYVQMS
MEYYLQEKRKMAKLLQDYKNALRSIKKHISHLDL*

FI06473.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18350-PA 231 GF18350-PA 1..231 9..234 518 47.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11455-PA 230 GG11455-PA 1..230 9..234 1039 84.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18120-PA 265 GH18120-PA 1..261 9..229 440 40.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dlip2-PA 226 CG9771-PA 1..226 9..234 1185 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23835-PA 259 GI23835-PA 1..256 9..232 463 39.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22174-PA 221 GL22174-PA 1..213 9..228 523 53.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22023-PA 236 GA22023-PA 1..228 9..228 525 50.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10690-PA 231 GM10690-PA 1..231 9..234 1130 90.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19665-PA 231 GD19665-PA 1..231 9..234 1136 90.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23293-PA 266 GJ23293-PA 1..263 9..232 434 37.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11594-PA 269 GK11594-PA 1..269 9..234 453 42.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25341-PA 232 GE25341-PA 1..232 9..234 1054 84.5 Plus
Dyak\GE14839-PA 232 GE14839-PA 1..232 9..234 1048 84.1 Plus