Clone FI06479 Report

Search the DGRC for FI06479

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:79
Vector:pOT2
Associated Gene/TranscriptCG8549-RA
Protein status:FI06479.pep: gold
Sequenced Size:912

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8549 2008-08-15 Release 5.9 accounting
CG8549 2008-12-18 5.12 accounting

Clone Sequence Records

FI06479.complete Sequence

912 bp assembled on 2008-07-28

GenBank Submission: BT044292.1

> FI06479.complete
ATTCCGCAGCTTGTATTTTAACAACAATGTCCAAAATATTCACGCCCACA
AATCAAATACGCCTCACAAATGTCGCCATTGTGAGGCTAAAAAAAGGTGG
CAAGCGATTTGAGATCGCCTGCTATAAAAATAAGGTTCTTTCGTGGAGGA
GCAACAGCGAAAAGGACATCGATGAGGTCCTGCAAACCCATACCGTGTTC
ACCAATGTCTCCAAAGGACAGGCGGCCAAAAAGGACGAGCTGCAAAAGGC
CTTCAATAAAACAGACGAGACTGAGATTTGCAAGGAGATCCTCAGCAAAG
GAGAACTGCAGGTGTCGGAAAAGGAGCGCCAAAGTTGTCTGGACACGCAA
CTAAATAGTATAGTTAATTCCGTGGCTGCGTTGTGTGTAAATCCAGAGAC
GCGTCGTCCATATCCCGCCTCCATCATCGAGAAATCCCTGAAGGATGCCC
ACTTCTCCGTTAAGATGAACAGGAACACCAAGCAGAACACACTGGAGGCC
ATCAAGATTCTCAAGGACCATATGCCCATCGAGAGGTCGCGCATGAAGCT
GCGCGTTAGCTTTGCTGGAAAGGAGGGCGGTGGCAAGCTCAAGGAATCGG
TGGTCAAGTTGGCCAACGCAGTGGAGCACGAGGAATGGGACGAGGCCACC
TTGCACTTAACCTTGCTCATAGATCCTGGCCAATATCGTGTCATTGATGA
GCTGGTAAGGAACGAAACGAAGGGTAAGGGACTGCTGGAGCTGCTCGAGC
TGAAGGAAGTGGTGGAGAGCGAGGAACTCTTCTAGGCAATACAATCCCTT
TAAAATTTTTTGTTTTTCTTTGTAATCTTGTTGATATTTATGTGAAACAT
AAAGCTGATAAGTACACAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAA

FI06479.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8549-RA 1085 CG8549-RA 190..1060 1..871 4355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6745702..6746415 156..869 3570 100 Plus
chr3L 24539361 chr3L 6745467..6745623 1..157 785 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6753316..6754031 156..871 3580 100 Plus
3L 28110227 3L 6753081..6753237 1..157 785 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6746416..6747131 156..871 3580 100 Plus
3L 28103327 3L 6746181..6746337 1..157 785 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:35:52 has no hits.

FI06479.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:37:00 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6745467..6745623 1..157 100 -> Plus
chr3L 6745704..6746415 158..869 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:57 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 1..759 27..785 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:58 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 1..759 27..785 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:10 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 1..759 27..785 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:08 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 1..759 27..785 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:41:29 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 1..759 27..785 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:10 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 169..1037 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:58 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 169..1037 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:10 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 169..1037 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:28 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 169..1037 1..869 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:41:29 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
CG8549-RA 169..1037 1..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:00 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6753081..6753237 1..157 100 -> Plus
3L 6753318..6754029 158..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:00 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6753081..6753237 1..157 100 -> Plus
3L 6753318..6754029 158..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:00 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6753081..6753237 1..157 100 -> Plus
3L 6753318..6754029 158..869 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:10 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6746181..6746337 1..157 100 -> Plus
arm_3L 6746418..6747129 158..869 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:12 Download gff for FI06479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6746418..6747129 158..869 100   Plus
3L 6746181..6746337 1..157 100 -> Plus

FI06479.hyp Sequence

Translation from 2 to 784

> FI06479.hyp
SAACILTTMSKIFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRS
NSEKDIDEVLQTHTVFTNVSKGQAAKKDELQKAFNKTDETEICKEILSKG
ELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASIIEKSLKDAH
FSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESV
VKLANAVEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLEL
KEVVESEELF*

FI06479.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8549-PB 252 CG8549-PB 1..252 9..260 1271 100 Plus
CG8549-PA 252 CG8549-PA 1..252 9..260 1271 100 Plus

FI06479.pep Sequence

Translation from 2 to 784

> FI06479.pep
SAACILTTMSKIFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRS
NSEKDIDEVLQTHTVFTNVSKGQAAKKDELQKAFNKTDETEICKEILSKG
ELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASIIEKSLKDAH
FSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESV
VKLANAVEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLEL
KEVVESEELF*

FI06479.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23548-PA 252 GF23548-PA 1..252 9..260 1191 96 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14387-PA 252 GG14387-PA 1..252 9..260 1321 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16108-PA 252 GH16108-PA 1..252 9..260 1145 92.1 Plus
Dgri\GH17974-PA 138 GH17974-PA 1..126 9..134 609 92.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8549-PB 252 CG8549-PB 1..252 9..260 1271 100 Plus
CG8549-PA 252 CG8549-PA 1..252 9..260 1271 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12377-PA 252 GI12377-PA 1..252 9..260 1147 92.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13275-PA 223 GL13275-PA 1..180 9..188 913 96.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21157-PA 252 GA21157-PA 1..231 9..239 1184 96.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14796-PA 177 GM14796-PA 1..174 9..182 922 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12267-PA 252 GJ12267-PA 1..252 9..260 1147 92.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12553-PA 253 GK12553-PA 1..232 9..239 1133 91.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21574-PA 252 GE21574-PA 1..252 9..260 1313 98.8 Plus