Clone FI06480 Report

Search the DGRC for FI06480

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:80
Vector:pOT2
Associated Gene/TranscriptCG1999-RA
Protein status:FI06480.pep: gold
Sequenced Size:1056

Clone Sequence Records

FI06480.complete Sequence

1056 bp assembled on 2009-04-06

GenBank Submission: BT081970.1

> FI06480.complete
CAAGACCAGACTCTAAATCTTATCGTAAAAAAGTTTACTAAAATTCCAAA
TTTAACAAACATATGGTGCAATAAGATTTTGCAAGACAAATCATTTGTGT
ATATCTAGAATCATGCAGCGTTCGTCTTATCCTCTATGCCACATTGTGCG
ACCCAGCTTGACTGGGCTTTTAGGCGGCGGATGGATTGACCTTCGAAGGA
CTATGGCCTCAGATTCGTGGGGACGGGGTGACGGCAATAGCCAGCCCAAT
TCGCCAAGGGCTGGCGTTTCGCGTGCCAGTGCCACATCGACGGTGATAAG
TGATGCCAGCTCCTATTCGCGTGGCGTCAACACTGGTGCTTTCGAGCGAC
GCATCAATCGGGAGGATAATATGTGGAGGGATCAGAGCTATATCGATACA
AAATGGTTAAATCCTCGCGATCCCAATGCCTATCGACCGAATTTCCGTCA
AACAGAGCCGACATCGTTGCGCAAGCAATTCATGCGCAGTCCGGATGAAA
TATCCCGTGAGGTGATGGGTCGTGATTGGGAGGAAACGGTCAGGACATAT
AAACGCAACGCCCAGAGCAAACACAGTGTGGCGCGCACAGAGGAGCGGCA
ATCTTCGGATAATACACGTAATCGCCAGCAACATTTGCAATTAATGCACA
TGCAACAGCAACAAAGGCAACAGCAGCAACATAAGAAAAATCAGCAGCAG
TACAACAATTGGGGCAGGAGTGTGGAGTCCCCCGAGGATCAATAATACCG
GCCCGAGATCAATAGACTACAGCCTAATTCTCCCAATATATCACACATAT
ATATATATAAGTATAATATATATATGTGTGTGTATATCCCAGTCAAGCAG
AGTTGAACTCCTAACAGTGATCCAATATCTTAATTCCGTCAAAGCTAACA
TTTGTTAAGTTCGTTCAGATGTTGATAAGAAAAGTTGACTGATTGCGCAA
CGAGATTCTATCATGTAAATCGAATCATATGATCAAAGATATAATTAAAT
TTTGGAAATAAATAAAACTTAGATAAGGTCAATTCGTTTAAAAAAAAAAA
AAAAAA

FI06480.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG1999-RA 1133 CG1999-RA 85..1128 1..1044 5220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7251057..7251989 107..1039 4665 100 Plus
chrX 22417052 chrX 7250779..7250886 1..108 540 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7359126..7360063 107..1044 4690 100 Plus
X 23542271 X 7358848..7358955 1..108 540 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7367224..7368161 107..1044 4690 100 Plus
X 23527363 X 7366946..7367053 1..108 540 100 Plus
Blast to na_te.dros performed 2019-03-16 15:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1061..1232 653..825 189 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6758..6856 626..720 180 69.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6838 626..720 178 68.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6791..6873 626..707 178 69.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2290..2471 517..708 171 58.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1533..1616 626..710 170 68.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2243..2387 563..708 168 60.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6803..6888 626..707 167 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2352..2441 626..717 167 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6807 637..719 167 70.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2765..2837 625..700 166 71.1 Plus
roo 9092 roo DM_ROO 9092bp 1073..1153 626..708 158 69 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6710..6786 644..719 157 68.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2297..2356 643..702 156 73.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6823 626..720 155 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2581..2656 638..716 154 71.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2367..2462 626..720 153 63.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2580..2681 605..709 150 64.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2607..2687 626..711 147 70.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2415..2492 626..708 142 67.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2429..2516 616..708 138 66 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2302..2412 663..773 131 62.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2805..2872 653..722 129 67.1 Plus
roo 9092 roo DM_ROO 9092bp 1097..1181 626..710 128 65.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2401 626..707 128 65.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1524..1593 638..708 127 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1583 651..720 120 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6827..6942 626..741 120 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6858..6922 621..685 118 64.6 Plus
roo 9092 roo DM_ROO 9092bp 1046..1162 588..700 116 58.1 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3279..3341 656..717 114 66.7 Plus

FI06480.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:08:59 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7250779..7250886 1..108 100 -> Plus
chrX 7251059..7251735 109..785 100 == Plus
chrX 7251788..7251986 838..1039 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:48 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
CG1999-RA 1..633 113..745 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:59 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
CG1999-RA 1..633 113..745 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:40:48 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
CG1999-RA 1..633 113..745 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:43 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
CG1999-RA 1..633 113..745 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-06 18:32:57 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
CG1999-RA 53..1091 1..1039 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:59 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
CG1999-RA 53..1091 1..1039 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:40:48 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
CG1999-RA 53..1091 1..1039 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:43 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
CG1999-RA 53..1091 1..1039 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:59 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
X 7358848..7358955 1..108 100 -> Plus
X 7359128..7360058 109..1039 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:59 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
X 7358848..7358955 1..108 100 -> Plus
X 7359128..7360058 109..1039 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:59 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
X 7358848..7358955 1..108 100 -> Plus
X 7359128..7360058 109..1039 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:40:48 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7252881..7252988 1..108 100 -> Plus
arm_X 7253161..7254091 109..1039 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:03 Download gff for FI06480.complete
Subject Subject Range Query Range Percent Splice Strand
X 7367226..7368156 109..1039 100   Plus
X 7366946..7367053 1..108 100 -> Plus

FI06480.hyp Sequence

Translation from 112 to 744

> FI06480.hyp
MQRSSYPLCHIVRPSLTGLLGGGWIDLRRTMASDSWGRGDGNSQPNSPRA
GVSRASATSTVISDASSYSRGVNTGAFERRINREDNMWRDQSYIDTKWLN
PRDPNAYRPNFRQTEPTSLRKQFMRSPDEISREVMGRDWEETVRTYKRNA
QSKHSVARTEERQSSDNTRNRQQHLQLMHMQQQQRQQQQHKKNQQQYNNW
GRSVESPEDQ*

FI06480.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG1999-PA 210 CG1999-PA 1..210 1..210 1122 100 Plus

FI06480.pep Sequence

Translation from 112 to 744

> FI06480.pep
MQRSSYPLCHIVRPSLTGLLGGGWIDLRRTMASDSWGRGDGNSQPNSPRA
GVSRASATSTVISDASSYSRGVNTGAFERRINREDNMWRDQSYIDTKWLN
PRDPNAYRPNFRQTEPTSLRKQFMRSPDEISREVMGRDWEETVRTYKRNA
QSKHSVARTEERQSSDNTRNRQQHLQLMHMQQQQRQQQQHKKNQQQYNNW
GRSVESPEDQ*

FI06480.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21142-PA 273 GF21142-PA 26..169 23..157 420 59.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19644-PA 213 GG19644-PA 1..213 1..210 761 73 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11884-PA 148 GH11884-PA 15..99 60..144 234 51.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG1999-PA 210 CG1999-PA 1..210 1..210 1122 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15672-PA 172 GI15672-PA 53..141 50..145 235 51 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14700-PA 219 GL14700-PA 103..176 63..143 162 40.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15177-PA 219 GA15177-PA 103..176 63..143 156 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17518-PA 214 GM17518-PA 1..214 1..210 908 87.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16842-PA 214 GD16842-PA 1..214 1..210 924 88.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19206-PA 201 GJ19206-PA 49..146 47..145 256 53.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16146-PA 244 GK16146-PA 1..185 1..149 292 38.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15715-PA 241 GE15715-PA 1..241 1..209 758 71.5 Plus