Clone FI06481 Report

Search the DGRC for FI06481

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:81
Vector:pOT2
Associated Gene/TranscriptCG3330-RA
Protein status:FI06481.pep: gold
Sequenced Size:1070

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3330 2008-12-18 5.12 accounting

Clone Sequence Records

FI06481.complete Sequence

1070 bp assembled on 2008-10-23

GenBank Submission: BT050496.1

> FI06481.complete
CTAACCAACAGAAACATTCGCATCCTGAAAATTTTTACAAAATTTCGGTA
TTACGTAAAATGATAGGCATTCAAAAAAAGCGACCAGCCGCCGGAGAGTA
CGTAGTGCCAAACAATTCGGCTCTAAATCTGCAGAATAAGCCCAGTATAT
ACGATCAAACGCCCAACCAAATGGAGAAGACCACCAAGTGCCGCTATTGT
GAGAACATGGCCAAGAACTTTCTGTACCTGGAGAGCCTGATCCGGAACAA
CAAGGATAACGACAAGAACAACAAGTGCAGCTTGTGCAACTCGTCGCTAA
AGTACTTGGAGTATGTTAACCGCAATATTCGCCAGGTTTTCGGCAACTTC
GATTCAATTGTCCAGGCGGATCGTGCTCTGCAATCCAAGCCGGCCATGAT
GCCCAAATACTCGGTGGGCCCGGCTCCGGAAAAAGCTGATCTGCGCTCCA
AGGGTGGCGCCATTGTCTCCCAGCAAAGGTCGGCAAAAAGCCTCAAGTCC
AAGAGCCTAAAATCCCTTAAATCTAAGTCCAAGGAGAAGAGCCAAAAGTC
ATTGAAGACGCTTAAATCGCGTAAATCTACCAAATCACTCAAGTCCTCCA
AGTCCACGAAGTCGAGCAAATCGCAGAAGTCATCCCTCAAGAAAATTCCA
ACCAAACCGAAGAGCGCTAGTCCCAAGACCCAAATCAGCCATGGCAAGAT
GATATTGAAGCGCAAATTCCGAAACAAGGTGGCTAGCAAGTTGGGCGGCA
ACAAAGTGGTTCGCAGCGTCAGTCAGTACCGCGGCCTGGGTTCCGCCCGC
TCCAAACTCTCGAAGGGATCTAGTCACAAGAAGCTGATCAAGCAGCGGTC
CGCCGCTCCACCGACCAGCATCAACTGGCAGCTCCTCAAAAGAAACCTGC
CCAAGCGGCCCAATCCAGTGAAGTAGGGGAAAAGATGACCGGCGATCGGC
AGATTGTCCTAAAATCCAATGCGTCCAGCCCAAATCTCTCATTTGTCAAA
ATTTTTTTAAGTGATCTTTGCATGAATAAACTGAAGAAGACATAGTTTAA
AAAAAAAAAAAAAAAAAAAA

FI06481.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG3330-RA 1198 CG3330-RA 143..1198 1..1056 5265 99.9 Plus
nc_19547.a 573 nc_19547.a 265..573 336..644 1545 100 Plus
nc_19547.a 573 nc_19547.a 1..266 11..276 1330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23152590..23153639 1048..1 5185 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27329685..27330740 1056..1 5265 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27070516..27071571 1056..1 5265 99.9 Minus
Blast to na_te.dros performed on 2019-03-16 18:03:56 has no hits.

FI06481.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:04:41 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23152590..23153639 1..1048 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:53:59 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 1..867 60..926 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:59 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 1..867 60..926 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:46 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 1..867 60..926 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:29:01 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 1..867 60..926 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:24 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 143..1190 1..1048 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:59 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 143..1190 1..1048 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:46 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 143..1190 1..1048 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-23 18:44:15 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 143..1190 1..1048 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:29:01 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
CG3330-RA 143..1190 1..1048 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:41 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27329693..27330740 1..1048 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:41 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27329693..27330740 1..1048 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:41 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27329693..27330740 1..1048 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:46 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23155415..23156462 1..1048 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:53 Download gff for FI06481.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27070524..27071571 1..1048 100   Minus

FI06481.pep Sequence

Translation from 2 to 925

> FI06481.pep
NQQKHSHPENFYKISVLRKMIGIQKKRPAAGEYVVPNNSALNLQNKPSIY
DQTPNQMEKTTKCRYCENMAKNFLYLESLIRNNKDNDKNNKCSLCNSSLK
YLEYVNRNIRQVFGNFDSIVQADRALQSKPAMMPKYSVGPAPEKADLRSK
GGAIVSQQRSAKSLKSKSLKSLKSKSKEKSQKSLKTLKSRKSTKSLKSSK
STKSSKSQKSSLKKIPTKPKSASPKTQISHGKMILKRKFRNKVASKLGGN
KVVRSVSQYRGLGSARSKLSKGSSHKKLIKQRSAAPPTSINWQLLKRNLP
KRPNPVK*

FI06481.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18711-PA 311 GF18711-PA 1..307 20..303 799 62.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12116-PA 294 GG12116-PA 1..294 20..307 1023 82.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23815-PA 218 GH23815-PA 1..211 69..302 375 47.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG3330-PA 288 CG3330-PA 1..288 20..307 1450 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24568-PA 268 GI24568-PA 1..262 20..302 515 48 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23589-PA 314 GL23589-PA 1..309 20..302 558 48.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17383-PA 287 GA17383-PA 1..282 20..302 555 51.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19225-PA 280 GM19225-PA 1..280 20..307 1193 92 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18080-PA 288 GD18080-PA 1..288 20..307 1166 94.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22634-PA 269 GJ22634-PA 1..266 20..306 525 49.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11338-PA 320 GK11338-PA 1..312 20..302 525 48.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10564-PA 298 GE10564-PA 1..298 20..307 1083 82.6 Plus

FI06481.hyp Sequence

Translation from 2 to 925

> FI06481.hyp
NQQKHSHPENFYKISVLRKMIGIQKKRPAAGEYVVPNNSALNLQNKPSIY
DQTPNQMEKTTKCRYCENMAKNFLYLESLIRNNKDNDKNNKCSLCNSSLK
YLEYVNRNIRQVFGNFDSIVQADRALQSKPAMMPKYSVGPAPEKADLRSK
GGAIVSQQRSAKSLKSKSLKSLKSKSKEKSQKSLKTLKSRKSTKSLKSSK
STKSSKSQKSSLKKIPTKPKSASPKTQISHGKMILKRKFRNKVASKLGGN
KVVRSVSQYRGLGSARSKLSKGSSHKKLIKQRSAAPPTSINWQLLKRNLP
KRPNPVK*

FI06481.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG3330-PA 288 CG3330-PA 1..288 20..307 1450 100 Plus