Clone FI06482 Report

Search the DGRC for FI06482

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:82
Vector:pOT2
Associated Gene/TranscriptCG5174-RA
Protein status:FI06482.pep: gold
Sequenced Size:987

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5174 2008-12-18 5.12 accounting

Clone Sequence Records

FI06482.complete Sequence

987 bp assembled on 2008-10-24

GenBank Submission: BT050497.1

> FI06482.complete
CGATAGCTAAGCAAGCGAAACAAAAATTATTTTCAACTTGAAAGTTTTGC
GACAAGTGCGTGCAGTTGGCATCGAAATAGTTAACAAAATTGCCGCAGAC
TTCCGGAGACAACGCCGTAATGGAGGACCATAATACAGCCAACCTGTCGG
AGCCAGCATCTCCAGCTAATTCTGTGGCATCCGCAGAAATTGCCGCCGAG
TTCGCTGCGCTTTCCGTCGAGGAGAAGGAGCAGCGTCGGGCTGAGTGGAG
TCAGGAGCTCGCCCGCGTTGAGGAAGAGATCAATACGCTGCGAACTGTCC
TAGCCTCCAAGACGCGCCATGCCTCCGATCTCAAGCGCAAGCTGGGCATC
ACCGTCTGGAAGGAGGTGACGGACGACGTGAACCAGGGCCTTAAGAACCT
CAAGGAGAGCACTGTTTACCAATCGGTGGAGCAGAGCGTGGGCACGTTTA
CTAAAACGGTGTACGAGGCACCACTATACCAACGCACTGAGTCGGTGCTA
AAGTCCACGGGCGAGAAGACCGCCTCGGTGTTTGGCAGCATCACCAGTGG
CATTTCGTCGAAACTGTCGCAAATGAAAAACTCCGAATCGATGCGTTCTA
TCGAGGCTTCGGTGGGCTCTGCCTACGAGAACGTTAAAACCAAGGTGACA
TCCCGCTCGGGTTCGGTGTCCAGTTTCCCAGATGCCCTGGACGAGAATAA
CACATCCTCGGGTCTGAATTCACCCACAGACTCACTCCCGAAATAGATTT
CGGGGCAACTGCAAGGCCAAGCGCGTCGATAATGTGGAGCAACCTATACT
ACATACAAACAGACCCACGCACCCACTCTATTAACTTATTTAACTAAAGC
GAATTGTCGTGTCTGCGCACTAACAACAGGATCAGAATTAATTTAACCAG
AAATCATATGTACACCTGTGTCGATACGGTTTATATAATACTTAATATAA
CTAAAATCTGCGCGTCAAAAAAAAAAAAAAAAAAAAA

FI06482.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG5174-RA 1654 CG5174-RA 126..1097 1..971 4820 99.8 Plus
CG5174.b 1696 CG5174.b 126..764 1..638 3155 99.8 Plus
CG5174-RM 1517 CG5174-RM 472..968 475..971 2485 100 Plus
CG5174.b 1696 CG5174.b 807..1139 639..971 1665 100 Plus
CG5174-RM 1517 CG5174-RM 187..479 130..422 1450 99.6 Plus
CG5174-RM 1517 CG5174-RM 15..144 1..129 610 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14312391..14312718 639..966 1640 100 Plus
chr2R 21145070 chr2R 14311374..14311537 252..415 820 100 Plus
chr2R 21145070 chr2R 14311923..14312085 476..638 815 100 Plus
chr2R 21145070 chr2R 14311178..14311303 130..255 630 100 Plus
chr2R 21145070 chr2R 14308475..14308608 1..133 575 97 Plus
chr2R 21145070 chr2R 14311658..14311717 416..475 300 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18425340..18425672 639..971 1665 100 Plus
2R 25286936 2R 18424323..18424486 252..415 820 100 Plus
2R 25286936 2R 18424872..18425034 476..638 815 100 Plus
2R 25286936 2R 18424127..18424252 130..255 630 100 Plus
2R 25286936 2R 18421424..18421557 1..133 605 98.5 Plus
2R 25286936 2R 18424607..18424666 416..475 300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18426539..18426871 639..971 1665 100 Plus
2R 25260384 2R 18425522..18425685 252..415 820 100 Plus
2R 25260384 2R 18426071..18426233 476..638 815 100 Plus
2R 25260384 2R 18425326..18425451 130..255 630 100 Plus
2R 25260384 2R 18422623..18422756 1..133 615 98.5 Plus
2R 25260384 2R 18425806..18425865 416..475 300 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:14:13 has no hits.

FI06482.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:15:24 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14312391..14312718 639..966 100   Plus
chr2R 14308475..14308604 1..129 97 -> Plus
chr2R 14311178..14311302 130..254 100 -> Plus
chr2R 14311377..14311537 255..415 100 -> Plus
chr2R 14311658..14311717 416..475 100 -> Plus
chr2R 14311923..14312085 476..638 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:00 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:16:29 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:05 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:54:31 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:56:01 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 15..981 1..966 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:16:28 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 15..981 1..966 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:05 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 12..978 1..966 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-24 12:45:09 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 15..981 1..966 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:54:31 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RA 12..978 1..966 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:15:24 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18421424..18421553 1..129 99 -> Plus
2R 18424127..18424251 130..254 100 -> Plus
2R 18424326..18424486 255..415 100 -> Plus
2R 18424607..18424666 416..475 100 -> Plus
2R 18424872..18425034 476..638 100 -> Plus
2R 18425340..18425667 639..966 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:15:24 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18421424..18421553 1..129 99 -> Plus
2R 18424127..18424251 130..254 100 -> Plus
2R 18424326..18424486 255..415 100 -> Plus
2R 18424607..18424666 416..475 100 -> Plus
2R 18424872..18425034 476..638 100 -> Plus
2R 18425340..18425667 639..966 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:15:24 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18421424..18421553 1..129 99 -> Plus
2R 18424127..18424251 130..254 100 -> Plus
2R 18424326..18424486 255..415 100 -> Plus
2R 18424607..18424666 416..475 100 -> Plus
2R 18424872..18425034 476..638 100 -> Plus
2R 18425340..18425667 639..966 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:05 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14312845..14313172 639..966 100   Plus
arm_2R 14308929..14309058 1..129 99 -> Plus
arm_2R 14311632..14311756 130..254 100 -> Plus
arm_2R 14311831..14311991 255..415 100 -> Plus
arm_2R 14312112..14312171 416..475 100 -> Plus
arm_2R 14312377..14312539 476..638 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:47:26 Download gff for FI06482.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18426539..18426866 639..966 100   Plus
2R 18422623..18422752 1..129 99 -> Plus
2R 18425326..18425450 130..254 100 -> Plus
2R 18425525..18425685 255..415 100 -> Plus
2R 18425806..18425865 416..475 100 -> Plus
2R 18426071..18426233 476..638 100 -> Plus

FI06482.pep Sequence

Translation from 119 to 745

> FI06482.pep
MEDHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARV
EEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVY
QSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLS
QMKNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLN
SPTDSLPK*

FI06482.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12177-PA 351 GF12177-PA 148..351 5..208 933 94.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21893-PA 364 GG21893-PA 161..364 5..208 1030 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21673-PA 351 GH21673-PA 148..351 5..208 939 89.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5174-PA 208 CG5174-PA 1..208 1..208 1020 100 Plus
CG5174-PL 209 CG5174-PL 1..209 1..208 1002 99 Plus
CG5174-PB 355 CG5174-PB 152..355 5..208 996 100 Plus
CG5174-PN 222 CG5174-PN 1..222 1..208 995 93.7 Plus
CG5174-PP 365 CG5174-PP 148..365 5..208 971 93.6 Plus
CG5174-PO 369 CG5174-PO 152..369 5..208 971 93.6 Plus
CG5174-PH 188 CG5174-PH 1..188 1..208 888 90.4 Plus
CG5174-PM 202 CG5174-PM 19..202 5..208 864 90.2 Plus
CG5174-PJ 186 CG5174-PJ 1..173 1..173 845 100 Plus
CG5174-PG 166 CG5174-PG 1..153 1..173 713 88.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20126-PA 350 GI20126-PA 147..350 5..208 953 90.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17776-PA 372 GL17776-PA 165..372 1..208 916 90.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18710-PC 208 GA18710-PC 1..208 1..208 952 92.3 Plus
Dpse\GA18710-PA 374 GA18710-PA 167..374 1..208 915 90.4 Plus
Dpse\GA18710-PB 361 GA18710-PB 158..361 5..208 914 92.2 Plus
Dpse\GA18710-PD 184 GA18710-PD 1..173 1..173 779 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21885-PA 364 GM21885-PA 161..364 5..208 1040 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11382-PA 221 GD11382-PA 18..221 5..208 1041 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19896-PA 350 GJ19896-PA 147..350 5..208 890 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22994-PA 352 GK22994-PA 149..352 5..208 921 92.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11969-PA 371 GE11969-PA 168..371 5..208 1028 98.5 Plus

FI06482.hyp Sequence

Translation from 119 to 745

> FI06482.hyp
MEDHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARV
EEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVY
QSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLS
QMKNSESMRSIEASVGSAYENVKTKVTSRSGSVSSFPDALDENNTSSGLN
SPTDSLPK*

FI06482.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5174-PA 208 CG5174-PA 1..208 1..208 1020 100 Plus
CG5174-PL 209 CG5174-PL 1..209 1..208 1002 99 Plus
CG5174-PB 355 CG5174-PB 152..355 5..208 996 100 Plus
CG5174-PN 222 CG5174-PN 1..222 1..208 995 93.7 Plus
CG5174-PP 365 CG5174-PP 148..365 5..208 971 93.6 Plus