Clone FI06485 Report

Search the DGRC for FI06485

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:85
Vector:pOT2
Associated Gene/TranscriptCG10962-RB
Protein status:FI06485.pep: gold
Sequenced Size:1085

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10962 2008-08-15 Release 5.9 accounting
CG10962 2008-12-18 5.12 accounting

Clone Sequence Records

FI06485.complete Sequence

1085 bp assembled on 2008-07-28

GenBank Submission: BT044293.1

> FI06485.complete
CCGGAATTCGTGAGCGATGGATCGTTGGCAGAATCGCGTGGCCGTTATCA
GTGGCGCCAGTTCCGGAATCGGAGCAGCCTGTGCCCGGCTTTTGGTGGCA
GCCGGTCTACAGGTGGTTGGCCTGGCCCGACGCACCGATCGCCTCGAGCA
GCTGCGCCAATCTTTGCCGGCGGAGCAGAGGATGCGCTTCCATCAGCACA
AATGCGATGTATCGCAGGAGTTGCAGGTGGACACGGCCTTCGAGTGGATT
GAAAAGGAACTGGGCGGCATCGATGTGCTGATCAATAATGCGGGCATTGT
GCTCGGTGGCCAGCTGATCGATATGCCCACCAAGGACATCAACAACATAC
TACAGACGAATCTCATGGGCAGCATTTACTGCACCAAATTGGCCGCCAGC
AGCATGAGACGCCGCCAGGTGGCTGGACATCTGATCTTTGTGAATAGCAC
GGCCGGAGTGGCCGGTTATAAGCCGGATCCGGCGGATGAGAGCCTCAACG
CGTACACGCCCAGCAAATTTGCCCTGACTGCCGTCCAGGAGATCTGCCGA
CAGGAGCTAATCAATCAAGGATCAAAAATTAAGACCACGAGCATCAATCC
CGGCTGGGTGGCCACCGAGATCGTTCCGGACGAAACGAAGGCCAAGCTGG
GCGAGGTAATCCTCCAGGCGGACGACGTCGCTCAGGCTGTACTGTACGCC
CTATCCACGCCACCGCACACTCAGGTGGAGCAGATAACGCTGAGGGCGGT
GGGCGAATACTTCTGATTGCCCGACAACACAACGCAGCCCCCGAGATTAG
GCAATCGACTTGCAGTGGAACAGTAAAAATCAAATAAAGGCGAACGACCC
GATCCGACATGGCGAACATGACACACGGCGAGATACTCACATACCCCCCC
ACATTTGGTTTGCCACAAACTGTTGGCACTCACCTCGTTTCGTTTTATTT
TTATTATTGTGTTCAGTTACGACGTAGTATATGTATATGTATATGTATAT
ATATATGGCATATGTGTTCAGCACCTTTCCTCAAGCCAAATAAATAATTC
AGTTTTGTGAACTAACAAAAAAAAAAAAAAAAAAA

FI06485.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10962-RB 1490 CG10962-RB 162..1225 1..1068 5015 98.1 Plus
CG10962-RA 1360 CG10962-RA 893..1360 590..1061 2170 97.6 Plus
CG10962.a 1512 CG10962.a 1045..1512 590..1061 2170 97.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8865360..8865948 589..1 2930 99.8 Minus
chrX 22417052 chrX 8864613..8865086 1066..589 2250 98.5 Minus
chrX 22417052 chrX 11655613..11655677 81..17 205 87.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8973655..8974243 589..1 2810 98.5 Minus
X 23542271 X 8972906..8973381 1068..589 2200 97.7 Minus
X 23542271 X 11764416..11764481 82..17 210 87.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8981753..8982341 589..1 2810 98.4 Minus
X 23527363 X 8981004..8981479 1068..589 2210 97.7 Minus
X 23527363 X 11772514..11772579 82..17 210 87.8 Minus
Blast to na_te.dros performed on 2019-03-15 12:17:08 has no hits.

FI06485.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:18:13 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8864613..8865085 590..1066 98 <- Minus
chrX 8865360..8865948 1..589 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:05 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 1..750 17..766 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:01 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 1..750 17..766 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:40:13 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 1..750 17..766 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:08 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 1..750 17..766 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:56:33 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 1..750 17..766 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:14 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 1..1062 1..1066 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:01 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 1..1062 1..1066 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:40:13 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 13..1074 1..1066 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:16 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 1..1062 1..1066 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:56:33 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
CG10962-RB 13..1074 1..1066 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:13 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
X 8972908..8973380 590..1066 97 <- Minus
X 8973655..8974243 1..589 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:13 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
X 8972908..8973380 590..1066 97 <- Minus
X 8973655..8974243 1..589 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:13 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
X 8972908..8973380 590..1066 97 <- Minus
X 8973655..8974243 1..589 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:40:13 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8866941..8867413 590..1066 97 <- Minus
arm_X 8867688..8868276 1..589 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:17 Download gff for FI06485.complete
Subject Subject Range Query Range Percent Splice Strand
X 8981006..8981478 590..1066 97 <- Minus
X 8981753..8982341 1..589 98   Minus

FI06485.hyp Sequence

Translation from 16 to 765

> FI06485.hyp
MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSL
PAEQRMRFHQHKCDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQL
IDMPTKDINNILQTNLMGSIYCTKLAASSMRRRQVAGHLIFVNSTAGVAG
YKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINPGWVAT
EIVPDETKAKLGEVILQADDVAQAVLYALSTPPHTQVEQITLRAVGEYF*

FI06485.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG10962-PB 249 CG10962-PB 1..249 1..249 1261 100 Plus
CG40485-PB 247 CG40485-PB 1..247 1..249 620 49.6 Plus
antdh-PA 250 CG1386-PA 1..248 1..247 618 49 Plus
CG9360-PA 251 CG9360-PA 1..249 1..247 581 50.4 Plus
CG9150-PB 251 CG9150-PB 1..251 1..249 577 47 Plus

FI06485.pep Sequence

Translation from 16 to 765

> FI06485.pep
MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSL
PAEQRMRFHQHKCDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQL
IDMPTKDINNILQTNLMGSIYCTKLAASSMRRRQVAGHLIFVNSTAGVAG
YKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINPGWVAT
EIVPDETKAKLGEVILQADDVAQAVLYALSTPPHTQVEQITLRAVGEYF*

FI06485.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19119-PA 249 GF19119-PA 1..249 1..249 1204 88.8 Plus
Dana\GF22156-PA 248 GF22156-PA 1..248 1..249 651 50.6 Plus
Dana\GF22361-PA 250 GF22361-PA 1..248 1..247 643 47.8 Plus
Dana\GF16365-PA 250 GF16365-PA 1..250 1..249 629 49.8 Plus
Dana\GF10960-PA 252 GF10960-PA 1..252 1..249 616 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19013-PA 249 GG19013-PA 1..249 1..249 1272 96.4 Plus
Dere\GG17505-PA 247 GG17505-PA 1..247 1..249 653 50 Plus
Dere\GG18873-PA 250 GG18873-PA 1..248 1..247 640 47.8 Plus
Dere\GG10137-PA 251 GG10137-PA 1..251 1..249 595 46.6 Plus
Dere\GG13756-PA 252 GG13756-PA 1..252 1..249 594 46.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12070-PA 249 GH12070-PA 1..249 1..249 1102 80.7 Plus
Dgri\GH12229-PA 250 GH12229-PA 1..250 1..249 693 51.6 Plus
Dgri\GH12228-PA 247 GH12228-PA 1..247 1..249 678 52.5 Plus
Dgri\GH12862-PA 247 GH12862-PA 1..247 1..249 636 50 Plus
Dgri\GH24588-PA 250 GH24588-PA 1..250 1..249 630 50.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG10962-PB 249 CG10962-PB 1..249 1..249 1261 100 Plus
CG40485-PC 247 CG40485-PC 1..247 1..249 620 49.6 Plus
CG40485-PB 247 CG40485-PB 1..247 1..249 620 49.6 Plus
antdh-PA 250 CG1386-PA 1..248 1..247 618 49 Plus
CG9360-PA 251 CG9360-PA 1..249 1..247 581 50.4 Plus
CG9150-PB 251 CG9150-PB 1..251 1..249 577 47 Plus
CG8757-PB 252 CG8757-PB 1..252 1..249 574 46.4 Plus
CG3301-PC 250 CG3301-PC 1..250 1..249 558 47.6 Plus
CG3301-PB 250 CG3301-PB 1..250 1..249 558 47.6 Plus
CG3301-PA 250 CG3301-PA 1..250 1..249 558 47.6 Plus
CG40486-PC 247 CG40486-PC 1..247 1..249 555 46.6 Plus
CG40486-PB 247 CG40486-PB 1..247 1..249 555 46.6 Plus
CG40485-PA 231 CG40485-PA 1..192 1..191 470 48.4 Plus
rdhB-PB 248 CG7077-PB 7..242 4..243 400 41.1 Plus
rdhB-PA 248 CG7077-PA 7..242 4..243 400 41.1 Plus
CG3699-PA 251 CG3699-PA 5..186 6..202 227 33.5 Plus
CG12171-PA 257 CG12171-PA 1..192 1..202 187 26.7 Plus
CG31549-PB 257 CG31549-PB 1..208 1..213 187 26.6 Plus
CG31549-PA 257 CG31549-PA 1..208 1..213 187 26.6 Plus
CG7601-PA 326 CG7601-PA 54..243 7..202 187 28.6 Plus
CG9265-PD 399 CG9265-PD 88..301 8..229 178 29.6 Plus
CG9265-PC 399 CG9265-PC 88..301 8..229 178 29.6 Plus
CG9265-PB 399 CG9265-PB 88..301 8..229 178 29.6 Plus
CG9265-PA 399 CG9265-PA 88..301 8..229 178 29.6 Plus
CG17121-PA 361 CG17121-PA 93..274 7..194 169 28.6 Plus
CG31548-PA 256 CG31548-PA 6..191 7..202 157 26.3 Plus
Mfe2-PB 598 CG3415-PB 9..160 3..150 154 29.4 Plus
Mfe2-PA 598 CG3415-PA 9..160 3..150 154 29.4 Plus
Pdh-PC 261 CG4899-PC 3..195 4..208 149 28.4 Plus
Pdh-PA 278 CG4899-PA 20..212 4..208 149 28.4 Plus
CG10425-PA 336 CG10425-PA 36..258 7..226 148 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15562-PA 270 GI15562-PA 1..244 1..244 1079 82.4 Plus
Dmoj\GI14955-PA 247 GI14955-PA 1..247 1..249 660 51.6 Plus
Dmoj\GI14956-PA 247 GI14956-PA 1..247 1..249 657 50 Plus
Dmoj\GI15762-PA 250 GI15762-PA 1..250 1..249 608 47.2 Plus
Dmoj\GI10833-PA 250 GI10833-PA 1..250 1..249 580 47.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13028-PA 249 GL13028-PA 1..249 1..249 1182 89.2 Plus
Dper\GL20303-PA 249 GL20303-PA 1..247 1..247 636 49.8 Plus
Dper\GL16539-PA 247 GL16539-PA 1..247 1..249 599 47 Plus
Dper\GL24037-PA 250 GL24037-PA 1..250 1..249 598 48.6 Plus
Dper\GL27161-PA 250 GL27161-PA 1..250 1..249 596 50.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25891-PA 249 GA25891-PA 1..249 1..249 1176 88.4 Plus
Dpse\GA12578-PA 249 GA12578-PA 1..247 1..247 635 49.8 Plus
Dpse\GA22691-PA 279 GA22691-PA 28..279 1..249 611 48 Plus
Dpse\GA26486-PA 250 GA26486-PA 1..250 1..249 606 49.4 Plus
Dpse\GA23088-PA 247 GA23088-PA 1..247 1..249 602 47 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13691-PA 249 GM13691-PA 1..249 1..249 1286 96.8 Plus
Dsec\GM11256-PA 250 GM11256-PA 1..248 1..247 646 48.6 Plus
Dsec\GM24579-PA 252 GM24579-PA 1..252 1..249 604 46.8 Plus
Dsec\GM13047-PA 251 GM13047-PA 1..251 1..249 601 49.8 Plus
Dsec\GM17962-PA 251 GM17962-PA 1..251 1..249 600 47 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16091-PA 249 GD16091-PA 1..249 1..249 1306 98.8 Plus
Dsim\GD23342-PA 247 GD23342-PA 1..247 1..249 650 50.8 Plus
Dsim\GD15999-PA 250 GD15999-PA 1..248 1..247 644 48.2 Plus
Dsim\GD15972-PA 251 GD15972-PA 1..251 1..249 602 50.2 Plus
Dsim\GD22600-PA 251 GD22600-PA 1..251 1..249 602 47 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15175-PA 249 GJ15175-PA 1..249 1..249 1105 81.1 Plus
Dvir\GJ18923-PA 247 GJ18923-PA 1..247 1..249 652 51.6 Plus
Dvir\GJ14832-PA 250 GJ14832-PA 1..250 1..249 642 51.6 Plus
Dvir\GJ23779-PA 249 GJ23779-PA 1..249 1..249 641 51.6 Plus
Dvir\GJ18619-PA 250 GJ18619-PA 1..248 1..247 637 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16827-PA 249 GK16827-PA 1..249 1..249 1041 77.1 Plus
Dwil\GK16521-PA 250 GK16521-PA 1..248 1..247 645 48.2 Plus
Dwil\GK19844-PA 249 GK19844-PA 1..249 1..249 634 48.8 Plus
Dwil\GK14222-PA 307 GK14222-PA 1..248 1..247 623 50.2 Plus
Dwil\GK14223-PA 250 GK14223-PA 1..250 1..249 615 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17424-PA 249 GE17424-PA 1..249 1..249 1263 94.8 Plus
Dyak\GE17313-PA 250 GE17313-PA 1..248 1..247 642 47.8 Plus
Dyak\GE15259-PA 247 GE15259-PA 1..247 1..249 640 50.4 Plus
Dyak\GE20052-PA 266 GE20052-PA 15..266 1..249 593 45.2 Plus
Dyak\GE18948-PA 251 GE18948-PA 1..251 1..249 592 46.6 Plus