Clone FI06489 Report

Search the DGRC for FI06489

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:89
Vector:pOT2
Associated Gene/Transcripticln-RA
Protein status:FI06489.pep: gold
Sequenced Size:844

Clone Sequence Records

FI06489.complete Sequence

844 bp assembled on 2009-04-06

GenBank Submission: BT081971.1

> FI06489.complete
TTGTTTGATCGCGCTTTTTACAAATAATTTAACAAGCTGTATTAAAATGG
TTCTTATTATGCGTGTTTCCCCGCCGGAACATGGTCTGTTGTATACGGCA
AACAATATCAAGCTGAAACTAGGCGACAAAGTGGTGGGCGAAGGCACAGT
TTACATTGCCCAAAACACGCTATCCTGGCAGCCAACTGAATTGGCGGAGG
GTATATCCATTGAGTGGAAGCAGGTTAGCCTGCACGGTATCTCTTCGAAT
CCGAGAAAGTGCATCTACTTCATGCTGGACCACAAAGTCGAGTGGAACGG
CGTCTACGGAGATCCTCCCCAGCAGGCAGTCAATGGTCGGAATGGCGGTG
GTTCGGAAGCGGAAGTGGACGAGGGAAATGGCAGCGATGAGCACGATGAG
GACGACAATTTCGAGGATGCCGTAGACGAGCAATTTGGAGAGGTCACAGA
GTGCTGGCTTATGCCGGAGGACATTCACACCGTAGACACTATGTACAGTG
CCATGACGACTTGCCAGGCCCTACATCCTGATTCGGCAAACAGTGATTCG
GAAGACAGCGATCCTATGCAGGATGCCGGTGGCTTAGAGGATGAGGCTAT
GGAGGAGGATGATGCATTGACGCTTGGGCGCAACGGCGTGCAGAATCTCA
GTTTGGACGACGACGAAGAGCGATTCGAGGACGCTGATGAGTGAAGCATA
ACCTATTTAAACATCAATACCACGTTTTATACCAGATAAAATGTACGATA
TATATGTATTGGATTAGATTTTGGAGTAATAAAGAGAACGCGGTAAGCGC
GATTAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI06489.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
icln-RA 913 icln-RA 105..912 1..808 4010 99.7 Plus
CG30105-RA 767 CG30105-RA 604..767 808..645 805 99.3 Minus
CG30105.a 498 CG30105.a 422..498 808..732 370 98.7 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13478302..13478944 166..808 3200 99.8 Plus
chr2R 21145070 chr2R 13478051..13478215 1..165 795 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17591238..17591880 166..808 3200 99.8 Plus
2R 25286936 2R 17590987..17591151 1..165 810 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17592437..17593079 166..808 3200 99.8 Plus
2R 25260384 2R 17592186..17592350 1..165 810 99.3 Plus
Blast to na_te.dros performed 2019-03-15 15:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
invader5 4038 invader5 INVADER5 4038bp 29..97 752..685 117 65.2 Minus
invader5 4038 invader5 INVADER5 4038bp 3715..3783 752..685 117 65.2 Minus

FI06489.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:08:25 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13478051..13478215 1..165 98 -> Plus
chr2R 13478302..13478945 166..810 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:46 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
icln-RA 1..648 47..694 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:54 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
icln-RA 1..648 47..694 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:03:27 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
icln-RA 1..648 47..694 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:44 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
icln-RA 1..648 47..694 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-06 17:46:24 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
icln-RA 22..830 1..810 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:54 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
icln-RA 22..830 1..810 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:03:27 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
icln-RA 24..832 1..810 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:44 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
icln-RA 24..832 1..810 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:25 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17590987..17591151 1..165 99 -> Plus
2R 17591238..17591881 166..810 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:25 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17590987..17591151 1..165 99 -> Plus
2R 17591238..17591881 166..810 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:25 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17590987..17591151 1..165 99 -> Plus
2R 17591238..17591881 166..810 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:03:27 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13478492..13478656 1..165 99 -> Plus
arm_2R 13478743..13479386 166..810 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:57 Download gff for FI06489.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17592437..17593080 166..810 99   Plus
2R 17592186..17592350 1..165 99 -> Plus

FI06489.pep Sequence

Translation from 1 to 693

> FI06489.pep
CLIALFTNNLTSCIKMVLIMRVSPPEHGLLYTANNIKLKLGDKVVGEGTV
YIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKCIYFMLDHKVEWNG
VYGDPPQQAVNGRNGGGSEAEVDEGNGSDEHDEDDNFEDAVDEQFGEVTE
CWLMPEDIHTVDTMYSAMTTCQALHPDSANSDSEDSDPMQDAGGLEDEAM
EEDDALTLGRNGVQNLSLDDDEERFEDADE*

FI06489.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11656-PA 209 GF11656-PA 1..209 16..230 817 75.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21803-PA 215 GG21803-PA 1..215 16..230 971 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20074-PA 237 GH20074-PA 1..237 16..230 760 70.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
icln-PA 215 CG4924-PA 1..215 16..230 1152 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18789-PA 239 GI18789-PA 1..239 16..230 785 72.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16784-PA 222 GL16784-PA 1..222 16..230 943 83.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18528-PA 222 GA18528-PA 1..222 16..230 942 83.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21806-PA 215 GM21806-PA 1..215 16..230 1098 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11295-PA 215 GD11295-PA 1..215 16..230 1116 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21819-PA 234 GJ21819-PA 1..222 16..218 743 72.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10720-PA 224 GK10720-PA 1..224 16..230 765 71.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\icln-PA 215 GE11880-PA 1..215 16..230 989 95.8 Plus

FI06489.hyp Sequence

Translation from 1 to 693

> FI06489.hyp
CLIALFTINLTSCIKMVLIMRVSPPEHGLLYTANNIKLKLGDKVVGEGTV
YIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKCIYFMLDHKVEWNG
VYGDPPQQAVNGRNGGGSEAEVDEGNGSDEHDEDDNFEDAVDEQFGEVTE
CWLMPEDIHTVDTMYSAMTTCQALHPDSANSDSEDSDPMQDAGGLEDEAM
EEDDALTLGRNGVQNLSLDDDEERFEDADE*

FI06489.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
icln-PA 215 CG4924-PA 1..215 16..230 1152 100 Plus