Clone FI06490 Report

Search the DGRC for FI06490

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:64
Well:90
Vector:pOT2
Associated Gene/TranscriptCG4447-RA
Protein status:FI06490.pep: gold
Sequenced Size:901

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4447 2008-08-15 Release 5.9 accounting
CG4447 2008-12-18 5.12 accounting

Clone Sequence Records

FI06490.complete Sequence

901 bp assembled on 2008-07-28

GenBank Submission: BT044295.1

> FI06490.complete
CCCAATTGAAAATCAGTTCCGCATTTAATCCAAACAAAATAGATTAAATT
TAAATAAAATGCTGCGAAGTGCACTGCATTTAGCTGCCCTAGGAGTGCGC
CAGACGCGAGTGTCGAGCTCCTCACCGAAATTACCTCTAATCCTGCAAAA
TAATCTAGAAAACACGAAATATCTACAAGTGGCGCGCGATTATGCAAAGG
GCAAGGACAAAAAGAAGGAAAAAGGCGGCAAGGGAAAGCCGGGCAAGGTG
GAAATCAATGAGCAGCAGCTGCGCGAGATCCTCAATTTCGATGGCCTGAA
TAGCCAGATGCAGAAGTCCGTGATGCAGATGAAGGAGGATTTTGTGAAGC
ACCTGTCGCTGCGATCCACCAGCGGTGCCATCGACACACTGCGCATCAAA
GTCGATGGCCAGGAGCACGAGCTGCAGGAACTGGCCCAAATCTCTCGCAA
GAATCCCAAGACCATCATAGTCAACATGATTGGCTTCCCGCAAACGATTC
CCGATGTCCTCAAAGCCATCGAAAAGAGTGGCATGAACCTTAATCCCCAA
CAGGATGGCACTACACTGTTCATACCCATCCCAAAGGTCACCAAGGAGCA
CAGGGAAAATCTATCCAAGAATGCCAAAGCTCTGTTCGTCAAATATCGCG
ATGCCATACGAGGCGTTCAGAACGAACACATTCGCAAGCTGAAAAAACAA
CCGGAACTTGGCAAGGATGATGCCTTCGCCGCACAGGCTCAGGTCACTGC
CATCGCGGATCGCTTCATCTCGGAGGCGGACAAGTTGCTGGCCAGCAAGC
AGAAGGAGCTGCTGGGCGATTAGGCCTAAGACCAAGACTGATTCCGCTCC
AAAAGCCTTAATAAATGTAAATGTTTAAACTTAAAAAAAAAAAAAAAAAA
A

FI06490.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG4447-RA 882 CG4447-RA 1..882 1..882 4410 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9356262..9357143 1..882 4215 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9364359..9365245 1..887 4435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9357459..9358345 1..887 4435 100 Plus
Blast to na_te.dros performed 2019-03-16 11:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 869..917 1..49 110 69.4 Plus

FI06490.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:31:48 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9356262..9357143 1..882 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:08 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:05 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:58:08 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:10 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:28 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 1..765 59..823 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:19 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:04 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:58:08 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 10..891 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:17 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:28 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
CG4447-RA 10..891 1..882 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:48 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9364359..9365240 1..882 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:48 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9364359..9365240 1..882 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:48 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9364359..9365240 1..882 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:58:08 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9357459..9358340 1..882 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:21 Download gff for FI06490.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9357459..9358340 1..882 100   Plus

FI06490.hyp Sequence

Translation from 58 to 822

> FI06490.hyp
MLRSALHLAALGVRQTRVSSSSPKLPLILQNNLENTKYLQVARDYAKGKD
KKKEKGGKGKPGKVEINEQQLREILNFDGLNSQMQKSVMQMKEDFVKHLS
LRSTSGAIDTLRIKVDGQEHELQELAQISRKNPKTIIVNMIGFPQTIPDV
LKAIEKSGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKYRDAI
RGVQNEHIRKLKKQPELGKDDAFAAQAQVTAIADRFISEADKLLASKQKE
LLGD*

FI06490.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG4447-PA 254 CG4447-PA 1..254 1..254 1268 100 Plus

FI06490.pep Sequence

Translation from 58 to 822

> FI06490.pep
MLRSALHLAALGVRQTRVSSSSPKLPLILQNNLENTKYLQVARDYAKGKD
KKKEKGGKGKPGKVEINEQQLREILNFDGLNSQMQKSVMQMKEDFVKHLS
LRSTSGAIDTLRIKVDGQEHELQELAQISRKNPKTIIVNMIGFPQTIPDV
LKAIEKSGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKYRDAI
RGVQNEHIRKLKKQPELGKDDAFAAQAQVTAIADRFISEADKLLASKQKE
LLGD*

FI06490.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10686-PA 255 GF10686-PA 1..255 1..254 1055 87.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15364-PA 254 GG15364-PA 1..254 1..254 1287 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14583-PA 262 GH14583-PA 2..261 1..254 964 70.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
mRRF1-PA 254 CG4447-PA 1..254 1..254 1268 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13908-PA 266 GI13908-PA 7..265 6..254 878 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22438-PA 105 GL22438-PA 1..104 151..254 481 86.5 Plus
Dper\GL22437-PA 126 GL22437-PA 1..123 1..115 141 38.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18189-PA 261 GA18189-PA 1..260 1..254 950 80.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25136-PA 133 GM25136-PA 1..104 1..104 531 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11766-PA 260 GJ11766-PA 2..259 1..254 898 73.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17631-PA 257 GK17631-PA 61..256 60..254 871 83.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20827-PA 254 GE20827-PA 1..254 1..254 1180 96.5 Plus