Clone FI06504 Report

Search the DGRC for FI06504

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:65
Well:4
Vector:pOT2
Associated Gene/TranscriptCG6036-RA
Protein status:FI06504.pep: gold
Sequenced Size:1189

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6036 2008-12-18 5.12 accounting

Clone Sequence Records

FI06504.complete Sequence

1189 bp assembled on 2008-10-27

GenBank Submission: BT050499.1

> FI06504.complete
AAATTTCGGGGACTTTGTAAAAATCATATGGGTCATAAAATGGGTGGCTT
CTTGGAAAAACCAGAAACTGAAAAGCAGGCTCAAGAGGGTCATGGGAATG
GGCTGCGATACTGCGTAAGTTCTATGCAAGGTTGGCGATTGGAAATGGAG
GATAGCCACTCGGCTGCTTGCCGGCTGAAGGATCCCTTCGCAACGTGGTC
ATATTTTGCGGTGTTCGATGGTCACGCTGGCAGTCAAATATCACTGCATT
GCGCTGAACATCTAATGAGTACTATATTGGAATCCGAATCTTTTTCGAAG
CACAAATACGAGGCTGGCATACGAGAGGGCTTCCTGCAGTTGGATGAGGA
TATGAGGAAGCTGTATCACGACCAGCAAGGCGGCTCGACGGCCATTTGTG
TTTTTGTATCACCGGACAAAATATATCTGGTCAATTGTGGTGACTCGCGT
GCAGTGATATCGCGAAATGGAGCAGCTGTCATCAGTACAATTGATCACAA
GCCGTTTTCTCCCAAAGAACAAGAACGCATTCAAAATGCCGGAGGCAGTG
TAATGATTAAAAGGATAAATGGCACTCTGGCAGTTTCCCGGGCCTTCGGT
GACTATGATTTCAAGAATGATGGCTCAAAGTCTCCTGTCGATCAGATGGT
GTCTCCGGAACCTGATATAATAGTTTGCAATCGGTCCGAACACGATGAAT
TCATAGTTGTAGCCTGCGATGGCATTTGGGATGTGATGACTAGCAGCGAG
GTTTGTGAATTTATTAGGTCACGGCTTTTGGTGACCTATGACCTGCCGAT
GATTGTTAACAGCGTATTGGATATTTGCCTGCATAAAGGCAGCAGGGACA
ATATGACACTGCTCCTCCTACTTTTGCCTGGAGCACCAAAGGTCGATATG
GATGCAGTTAAGGCCGAAAGGAGTCTTGATCAAACTATTGTGCAAATAAC
CAAGGAAGTGATTGAGAAGCACGAAATACACGACTTTGAAACACTTATAC
GACTGATGAAAAGAATGGCCATTAACATTCCAAATCTACCACCTGGCGGT
GGTCTTTATGCAAAATATTACATTATAGAGCAAGCTTTCCACGAGAAATT
TCCAGATACTCCGGCTGAAATATATGATTATTTTTCCATGTAGAATATTT
GATGAGCACATAAGTCAAGTAAATTAAAGTTTATCGGCA

FI06504.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG6036-RA 1184 CG6036-RA 1..1184 1..1184 5920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22167327..22168510 1184..1 5800 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26344290..26345473 1184..1 5920 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26085121..26086304 1184..1 5920 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:01:54 has no hits.

FI06504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:03:02 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22167323..22168510 1..1188 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:10 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1116 28..1143 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:01 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1116 28..1143 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:59:00 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1116 28..1143 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:25 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1116 28..1143 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:56:46 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1135 9..1143 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:01 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1184 1..1184 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:59:00 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1184 1..1184 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-27 09:48:53 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1135 9..1143 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:25 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
CG6036-RA 1..1184 1..1184 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:02 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26344286..26345473 1..1188 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:02 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26344286..26345473 1..1188 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:02 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26344286..26345473 1..1188 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:59:00 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22170008..22171195 1..1188 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:03 Download gff for FI06504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26085117..26086304 1..1188 99   Minus

FI06504.pep Sequence

Translation from 0 to 1142

> FI06504.pep
KFRGLCKNHMGHKMGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEME
DSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSK
HKYEAGIREGFLQLDEDMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSR
AVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFG
DYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSE
VCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLLLLLPGAPKVDM
DAVKAERSLDQTIVQITKEVIEKHEIHDFETLIRLMKRMAINIPNLPPGG
GLYAKYYIIEQAFHEKFPDTPAEIYDYFSM*

FI06504.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20730-PA 366 GF20730-PA 1..366 14..380 1282 61 Plus
Dana\GF23353-PA 371 GF23353-PA 1..368 14..377 1079 53.7 Plus
Dana\GF24378-PA 374 GF24378-PA 1..285 14..292 528 39.9 Plus
Dana\GF24758-PA 349 GF24758-PA 1..284 14..290 492 37.3 Plus
Dana\GF18976-PA 707 GF18976-PA 398..571 125..290 303 38.5 Plus
Dana\GF18976-PA 707 GF18976-PA 1..102 14..118 167 31.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12191-PA 367 GG12191-PA 1..367 14..380 1807 90.7 Plus
Dere\GG11671-PA 374 GG11671-PA 1..364 14..373 1062 54 Plus
Dere\GG14269-PA 370 GG14269-PA 1..284 14..292 507 40.3 Plus
Dere\GG14729-PA 353 GG14729-PA 1..286 14..292 500 36.5 Plus
Dere\GG10863-PA 664 GG10863-PA 392..599 125..322 329 37 Plus
Dere\GG10863-PA 664 GG10863-PA 1..102 14..118 188 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18902-PA 371 GH18902-PA 1..368 14..377 1082 53.9 Plus
Dgri\GH16235-PA 323 GH16235-PA 1..295 14..300 501 36.5 Plus
Dgri\GH15705-PA 335 GH15705-PA 1..296 14..302 496 38.9 Plus
Dgri\GH20157-PA 774 GH20157-PA 479..652 125..290 307 40.2 Plus
Dgri\GH23728-PA 302 GH23728-PA 7..180 125..290 304 40.2 Plus
Dgri\GH20157-PA 774 GH20157-PA 1..102 14..118 177 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6036-PA 371 CG6036-PA 1..371 10..380 1954 100 Plus
alph-PB 371 CG1906-PB 1..368 14..377 1050 53.4 Plus
alph-PC 368 CG1906-PC 1..364 14..373 1036 53.4 Plus
alph-PD 368 CG1906-PD 1..364 14..373 1036 53.4 Plus
alph-PA 368 CG1906-PA 1..364 14..373 1036 53.4 Plus
alph-PE 374 CG1906-PE 1..364 14..373 1036 53.4 Plus
alph-PF 332 CG1906-PF 1..311 14..319 920 55.6 Plus
CG17746-PB 371 CG17746-PB 1..295 14..302 505 39.6 Plus
CG17746-PA 371 CG17746-PA 1..295 14..302 505 39.6 Plus
Ppm1-PA 352 CG12169-PA 1..286 14..292 490 37.2 Plus
CG10417-PB 662 CG10417-PB 390..562 125..290 314 41 Plus
CG10417-PA 662 CG10417-PA 390..562 125..290 314 41 Plus
CG10376-PA 428 CG10376-PA 192..419 65..292 270 29.2 Plus
Pp2C1-PB 1427 CG2984-PB 253..526 32..261 232 29.3 Plus
Pp2C1-PA 1427 CG2984-PA 253..526 32..261 232 29.3 Plus
CG7115-PC 469 CG7115-PC 268..446 128..309 225 33.3 Plus
CG7115-PD 471 CG7115-PD 270..448 128..309 225 33.3 Plus
CG7115-PE 524 CG7115-PE 323..501 128..309 225 33.3 Plus
CG7115-PB 524 CG7115-PB 323..501 128..309 225 33.3 Plus
CG7115-PA 524 CG7115-PA 323..501 128..309 225 33.3 Plus
CG10417-PB 662 CG10417-PB 1..102 14..118 180 32.4 Plus
CG10417-PA 662 CG10417-PA 1..102 14..118 180 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23119-PA 371 GI23119-PA 1..368 14..377 1086 53.7 Plus
Dmoj\GI12760-PA 328 GI12760-PA 1..296 14..302 497 37.8 Plus
Dmoj\GI16663-PA 329 GI16663-PA 1..286 14..292 487 36.2 Plus
Dmoj\GI20667-PA 747 GI20667-PA 445..618 125..290 299 39.1 Plus
Dmoj\GI21350-PA 520 GI21350-PA 319..479 127..292 238 32.7 Plus
Dmoj\GI20667-PA 747 GI20667-PA 1..102 14..118 169 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26287-PA 366 GL26287-PA 1..364 14..377 1296 62.6 Plus
Dper\GL13894-PA 370 GL13894-PA 1..367 14..377 1068 53.5 Plus
Dper\GL21276-PA 375 GL21276-PA 1..296 14..302 524 39.8 Plus
Dper\GL22500-PA 319 GL22500-PA 1..284 14..290 501 38.5 Plus
Dper\GL22499-PA 319 GL22499-PA 1..284 14..290 494 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28805-PA 366 GA28805-PA 1..364 14..377 1298 62.6 Plus
Dpse\GA15122-PA 370 GA15122-PA 1..367 14..377 1068 53.5 Plus
Dpse\GA14642-PA 375 GA14642-PA 1..296 14..302 524 39.8 Plus
Dpse\GA24460-PA 319 GA24460-PA 1..284 14..290 508 38.8 Plus
Dpse\GA24456-PA 319 GA24456-PA 1..284 14..290 497 38.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10187-PA 305 GM10187-PA 26..305 101..380 1457 97.1 Plus
Dsec\GM12795-PA 374 GM12795-PA 1..364 14..373 1056 53.4 Plus
Dsec\GM13564-PA 319 GM13564-PA 1..315 14..323 928 54.6 Plus
Dsec\GM14062-PA 370 GM14062-PA 1..284 14..292 511 39.9 Plus
Dsec\GM14345-PA 353 GM14345-PA 1..286 14..292 498 36.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18139-PA 305 GD18139-PA 26..305 101..380 1458 97.1 Plus
Dsim\GD21442-PA 374 GD21442-PA 1..364 14..373 1056 53.4 Plus
Dsim\GD13337-PA 370 GD13337-PA 1..284 14..292 511 39.9 Plus
Dsim\GD17616-PA 353 GD17616-PA 1..286 14..292 493 36.8 Plus
Dsim\GD21815-PA 428 GD21815-PA 189..419 62..292 270 28.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10608-PA 371 GJ10608-PA 1..368 14..377 1098 54.5 Plus
Dvir\GJ12915-PA 335 GJ12915-PA 1..286 14..292 523 37.3 Plus
Dvir\GJ15526-PA 329 GJ15526-PA 1..285 14..292 517 39.2 Plus
Dvir\GJ20416-PA 729 GJ20416-PA 448..621 125..290 306 39.7 Plus
Dvir\GJ20430-PA 446 GJ20430-PA 211..444 68..299 240 30 Plus
Dvir\GJ20416-PA 729 GJ20416-PA 1..102 14..118 184 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11903-PA 371 GK11903-PA 1..368 14..377 1064 52.8 Plus
Dwil\GK10512-PA 391 GK10512-PA 1..294 14..300 532 39.9 Plus
Dwil\GK16640-PA 378 GK16640-PA 11..305 14..300 474 35.4 Plus
Dwil\GK10630-PA 721 GK10630-PA 439..616 125..293 318 41 Plus
Dwil\GK14821-PA 546 GK14821-PA 328..488 127..292 240 32.7 Plus
Dwil\GK10630-PA 721 GK10630-PA 1..102 14..118 159 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10634-PA 367 GE10634-PA 1..367 14..380 1807 91.3 Plus
Dyak\GE23859-PA 374 GE23859-PA 1..364 14..373 1062 54 Plus
Dyak\GE20697-PA 370 GE20697-PA 1..284 14..292 511 40.3 Plus
Dyak\GE21091-PA 358 GE21091-PA 1..286 14..292 501 36.8 Plus
Dyak\GE11243-PA 634 GE11243-PA 362..534 125..290 341 42.2 Plus
Dyak\GE11243-PA 634 GE11243-PA 1..102 14..118 182 32.4 Plus

FI06504.hyp Sequence

Translation from 0 to 1142

> FI06504.hyp
KFRGLCKNHMGHKMGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEME
DSHSAACRLKDPFATWSYFAVFDGHAGSQISLHCAEHLMSTILESESFSK
HKYEAGIREGFLQLDEDMRKLYHDQQGGSTAICVFVSPDKIYLVNCGDSR
AVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFG
DYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSE
VCEFIRSRLLVTYDLPMIVNSVLDICLHKGSRDNMTLLLLLLPGAPKVDM
DAVKAERSLDQTIVQITKEVIEKHEIHDFETLIRLMKRMAINIPNLPPGG
GLYAKYYIIEQAFHEKFPDTPAEIYDYFSM*

FI06504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG6036-PA 371 CG6036-PA 1..371 10..380 1954 100 Plus
alph-PB 371 CG1906-PB 1..368 14..377 1050 53.4 Plus
alph-PC 368 CG1906-PC 1..364 14..373 1036 53.4 Plus
alph-PD 368 CG1906-PD 1..364 14..373 1036 53.4 Plus
alph-PA 368 CG1906-PA 1..364 14..373 1036 53.4 Plus