Clone FI06520 Report

Search the DGRC for FI06520

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:65
Well:20
Vector:pOT2
Associated Gene/TranscriptRpL37b-RA
Protein status:FI06520.pep: gold
Sequenced Size:422

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpL37b 2008-08-15 Release 5.9 accounting
RpL37b 2008-12-18 5.12 accounting

Clone Sequence Records

FI06520.complete Sequence

422 bp assembled on 2008-07-29

GenBank Submission: BT044298.1

> FI06520.complete
AGTTCTTCAGAGCAGAACTTTCTTTGACTCCGGAATTTATCTAGTATATC
ATTTGGCCATTTTGGCCAGAATCGCATTGAAGAAAGATGACCAAGGGAAC
CACTAGTTTTGGAAAGCGCCACAACAAGACGCACACCATCTGTCGCCGGT
GCGGCAACTCGTCGTACCATCTGCAGAAATCGAAGTGCTCCCAGTGCGGC
TATCCTGCGGCCAAGACCCGAAGCTTCAACTGGTCCCGAAAGGCCAAGGG
TCGCAAGGCGCAGGGAACGGGAAGGATGCGGTACCTCAAGAATCTGCGCC
GTCGTTTTCGCAACGGATTGCGTGAAGGAGGTGCCGCTAAGAAAAAAACC
AACTAAGTGGCGAAAGGAGTCTTTGATAAGTCCAATAAAAGCCGAATGAA
CGCAAAAAAAAAAAAAAAAAAA

FI06520.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37b-RA 403 RpL37b-RA 1..403 1..403 2015 100 Plus
RpL37a-RA 1226 RpL37a-RA 161..324 85..248 250 76.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18986514..18986916 403..1 1985 99.5 Minus
chrX 22417052 chrX 15029138..15029264 215..89 215 78 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23100056..23100459 404..1 2020 100 Minus
X 23542271 X 15138989..15139115 215..89 215 78 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23101255..23101658 404..1 2020 100 Minus
X 23527363 X 15147087..15147213 215..89 215 77.9 Minus
Blast to na_te.dros performed on 2019-03-16 04:38:11 has no hits.

FI06520.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:39:11 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18986514..18986916 1..403 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:17 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..270 87..356 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:29 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..270 87..356 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:25 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..270 87..356 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:33 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..270 87..356 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:46:51 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..270 87..356 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:41 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..270 87..356 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:28 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..403 1..403 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:25 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 20..422 1..403 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:20:10 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..270 87..356 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:46:51 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 20..422 1..403 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:11 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23100057..23100459 1..403 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:11 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23100057..23100459 1..403 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:11 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23100057..23100459 1..403 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:25 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18987580..18987982 1..403 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:46 Download gff for FI06520.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23101274..23101676 1..403 100   Minus

FI06520.hyp Sequence

Translation from 86 to 355

> FI06520.hyp
MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWS
RKAKGRKAQGTGRMRYLKNLRRRFRNGLREGGAAKKKTN*

FI06520.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37b-PA 89 CG9873-PA 1..89 1..89 485 100 Plus
RpL37a-PB 93 CG9091-PB 1..87 1..87 372 77 Plus
RpL37a-PA 93 CG9091-PA 1..87 1..87 372 77 Plus

FI06520.pep Sequence

Translation from 86 to 355

> FI06520.pep
MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWS
RKAKGRKAQGTGRMRYLKNLRRRFRNGLREGGAAKKKTN*

FI06520.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13322-PA 90 GF13322-PA 1..88 1..88 378 83 Plus
Dana\GF21054-PA 105 GF21054-PA 13..98 2..87 344 76.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20067-PA 89 GG20067-PA 1..89 1..89 430 92.1 Plus
Dere\GG19417-PA 94 GG19417-PA 1..87 1..87 349 77 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24309-PA 106 GH24309-PA 15..100 2..87 341 76.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37b-PA 89 CG9873-PA 1..89 1..89 485 100 Plus
RpL37a-PB 93 CG9091-PB 1..87 1..87 372 77 Plus
RpL37a-PA 93 CG9091-PA 1..87 1..87 372 77 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21554-PA 105 GI21554-PA 14..99 2..87 346 77.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13157-PA 64 GL13157-PA 1..57 31..87 194 70.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15582-PA 89 GM15582-PA 1..89 1..89 438 96.6 Plus
Dsec\GM12004-PA 94 GM12004-PA 1..87 1..87 349 77 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15698-PA 96 GJ15698-PA 5..90 2..87 340 76.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16414-PA 94 GK16414-PA 1..87 1..87 349 77 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11606-PA 89 GE11606-PA 1..89 1..89 431 93.3 Plus
Dyak\GE16068-PA 94 GE16068-PA 1..87 1..87 349 77 Plus