Clone FI06539 Report

Search the DGRC for FI06539

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:65
Well:39
Vector:pOT2
Associated Gene/TranscriptCG18731-RA
Protein status:FI06539.pep: gold
Sequenced Size:618

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18731 2008-08-15 Release 5.9 accounting
CG18731 2008-12-18 5.12 accounting

Clone Sequence Records

FI06539.complete Sequence

618 bp assembled on 2008-07-29

GenBank Submission: BT044299.1

> FI06539.complete
GCCACTTCATTATTTACCACTGTTTTGTAAACAATTGCAGAAAATTTATT
GAATTCCATTTTACGGCTTATATACGGGTTTTAGACTAAATTGTTAGTAC
GATAATTAACCTTAATATCACTAAGACTACGAGACTCGATACATCAGTTT
CAAGGAAACAGACGATGTTTAGGAAGTCCAGGCCCAAAGTAGAGCCTCCA
CCCACGGCTCCCAGTGTAGAGGAAATGCTGGCGGACATGGAAACGTTCGA
GGTCAATCAGCCTACGATAAGCGGATCTACAGACAACTTGGACTTGGAGC
ACGCTTTCATGACTGAACCAGAGAATCTTCCCCTTTCAACATGGTGGCAG
ATGTTCGACGAGTACGATCAGAAGGTGAAGAAACTGTCGGCCACCGTGGG
AGATCTGGAGACCCAACGAAATCAGTTAAAAGAATGCTATGCGAAGCTGG
AAAATAACGCGGATAAACTGAGAACGGACATCCAAAAGCAGCAGGCACTG
GTCAAAGAAGCCCTTAAATGTTAATCTATCATTAAGCTACCTTATCTTAA
ACTATTGTTGAATGCACGAGCGGGTAACAAGTAAAACCTAAAAACTCCAC
AAAAAAAAAAAAAAAAAA

FI06539.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG18731-RA 647 CG18731-RA 6..607 1..602 3010 100 Plus
CG18731.a 616 CG18731.a 161..616 146..601 2280 100 Plus
CG18731.a 616 CG18731.a 1..149 1..149 745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25547846..25548300 146..600 2260 99.8 Plus
chr3R 27901430 chr3R 25547637..25547783 1..147 615 94.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29725236..29725692 146..602 2285 100 Plus
3R 32079331 3R 29725027..29725173 1..147 735 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29466067..29466523 146..602 2285 100 Plus
3R 31820162 3R 29465858..29466004 1..147 735 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:31:18 has no hits.

FI06539.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:32:00 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25547637..25547783 1..147 94 -> Plus
chr3R 25547848..25548300 148..600 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:19 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..360 165..524 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:53 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..360 165..524 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:38:59 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..360 165..524 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:38 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..360 165..524 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:14 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..360 165..524 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:22 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:52 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:38:59 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:19:45 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:14 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
CG18731-RA 1..600 1..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:32:00 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29725027..29725173 1..147 100 -> Plus
3R 29725238..29725690 148..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:32:00 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29725027..29725173 1..147 100 -> Plus
3R 29725238..29725690 148..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:32:00 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29725027..29725173 1..147 100 -> Plus
3R 29725238..29725690 148..600 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:38:59 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25550749..25550895 1..147 100 -> Plus
arm_3R 25550960..25551412 148..600 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:17 Download gff for FI06539.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29466069..29466521 148..600 100   Plus
3R 29465858..29466004 1..147 100 -> Plus

FI06539.hyp Sequence

Translation from 164 to 523

> FI06539.hyp
MFRKSRPKVEPPPTAPSVEEMLADMETFEVNQPTISGSTDNLDLEHAFMT
EPENLPLSTWWQMFDEYDQKVKKLSATVGDLETQRNQLKECYAKLENNAD
KLRTDIQKQQALVKEALKC*

FI06539.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG18731-PB 119 CG18731-PB 1..119 1..119 624 100 Plus
CG18731-PA 119 CG18731-PA 1..119 1..119 624 100 Plus

FI06539.pep Sequence

Translation from 164 to 523

> FI06539.pep
MFRKSRPKVEPPPTAPSVEEMLADMETFEVNQPTISGSTDNLDLEHAFMT
EPENLPLSTWWQMFDEYDQKVKKLSATVGDLETQRNQLKECYAKLENNAD
KLRTDIQKQQALVKEALKC*

FI06539.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23366-PA 119 GF23366-PA 1..118 1..118 437 65.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11686-PA 119 GG11686-PA 1..119 1..119 544 87.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14321-PA 119 GH14321-PA 1..119 1..119 377 58 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG18731-PB 119 CG18731-PB 1..119 1..119 624 100 Plus
CG18731-PA 119 CG18731-PA 1..119 1..119 624 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10417-PA 119 GI10417-PA 1..119 1..119 398 62.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13908-PA 118 GL13908-PA 1..117 1..117 306 59.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15056-PA 118 GA15056-PA 1..117 1..117 385 59.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12810-PA 119 GM12810-PA 1..119 1..119 603 94.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21456-PA 119 GD21456-PA 1..119 1..119 616 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10633-PA 119 GJ10633-PA 1..119 1..119 398 61.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11916-PA 121 GK11916-PA 1..121 1..119 384 59.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23875-PA 119 GE23875-PA 1..119 1..119 541 86.6 Plus