Clone FI06587 Report

Search the DGRC for FI06587

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:65
Well:87
Vector:pOT2
Associated Gene/TranscriptmRpL54-RA
Protein status:FI06587.pep: gold
Sequenced Size:667

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL54 2008-08-15 Release 5.9 accounting
mRpL54 2008-12-18 5.12 accounting

Clone Sequence Records

FI06587.complete Sequence

667 bp assembled on 2008-07-29

GenBank Submission: BT044303.1

> FI06587.complete
AAAACGCACAGTTTTGTAAATATCTGTAATTTATCATTTGTTTTTCTATT
AAAGTGACGAAAACGGATTAAATAAAGCACATAGCAGACATGACCAGCCT
AACCGCAGTTTTCCAGATGGCGAGGCAGCGATTGATAGCCCCAGCGATAG
GAAACTGGGCACGTTTTTATGCTGCAAAACCGGCGGCGCCAGCGGGCAAG
AAGAAAAAGCTTGGCAAGCTGGGTCCCATCATGGAGAAGAAAGTCATACC
CGTGGAAACGGATGCCAACAAATTGGTGAACTATGTATGCGGAAGTAACT
ACATGAAAACAGGAGAAGATATCAAAATTAAACCGGATTCGGAATACCCC
GACTGGCTGTGGACGCTGAATACGGAAGGCATCGTTCCGCTGGACGAACT
GGACCCCAACTCCAAGCAGTACTGGCGCCGTCTGAGGAAACTGGCCTTGC
GGCGCAACAATCAGCTGTCCAAGCTAAAGAAGTTCTAGAACCCATAGCCC
TAGGTGTTATCGTTGATTTTGGAGACACAGCCGACCGTCACAGCGGCCCA
TGTTGTTTGCGATGCTCTCCTGAGCAACAAGTGTGCAAACACCATGTTAT
TTTGCTAAAAGCGAATTGCAAATACATTTATTGCACCGTCTTATCATAAA
AAAAAAAAAAAAAAAAA

FI06587.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL54-RA 772 mRpL54-RA 85..735 1..651 3180 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16947700..16948020 327..647 1605 100 Plus
chr2R 21145070 chr2R 16947257..16947448 1..192 960 100 Plus
chr2R 21145070 chr2R 16947503..16947639 190..326 670 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21061270..21061591 330..651 1565 99.1 Plus
2R 25286936 2R 21060824..21061015 1..192 960 100 Plus
2R 25286936 2R 21061070..21061206 190..326 670 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21062469..21062790 330..651 1565 99 Plus
2R 25260384 2R 21062023..21062214 1..192 960 100 Plus
2R 25260384 2R 21062269..21062405 190..326 670 99.2 Plus
Blast to na_te.dros performed 2019-03-15 23:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 4038..4105 639..575 106 67.6 Minus

FI06587.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:15:33 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16947257..16947448 1..192 100 -> Plus
chr2R 16947506..16947639 193..326 99 -> Plus
chr2R 16947700..16948020 327..647 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:31 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 1..399 90..488 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:42 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 1..399 90..488 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:31 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 1..399 90..488 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:35 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 1..399 90..488 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:25:48 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 1..399 90..488 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:04 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 1..647 1..647 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:42 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 46..692 1..647 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:31 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 36..682 1..647 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:20:54 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 1..647 1..647 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:25:48 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 36..682 1..647 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:33 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21060824..21061015 1..192 100 -> Plus
2R 21061073..21061206 193..326 99 -> Plus
2R 21061267..21061587 327..647 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:33 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21060824..21061015 1..192 100 -> Plus
2R 21061073..21061206 193..326 99 -> Plus
2R 21061267..21061587 327..647 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:33 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21060824..21061015 1..192 100 -> Plus
2R 21061073..21061206 193..326 99 -> Plus
2R 21061267..21061587 327..647 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:31 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16948329..16948520 1..192 100 -> Plus
arm_2R 16948578..16948711 193..326 99 -> Plus
arm_2R 16948772..16949092 327..647 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:04 Download gff for FI06587.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21062466..21062786 327..647 98   Plus
2R 21062023..21062214 1..192 100 -> Plus
2R 21062272..21062405 193..326 99 -> Plus

FI06587.pep Sequence

Translation from 89 to 487

> FI06587.pep
MTSLTAVFQMARQRLIAPAIGNWARFYAAKPAAPAGKKKKLGKLGPIMEK
KVIPVETDANKLVNYVCGSNYMKTGEDIKIKPDSEYPDWLWTLNTEGIVP
LDELDPNSKQYWRRLRKLALRRNNQLSKLKKF*

FI06587.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11928-PA 132 GF11928-PA 1..132 1..132 483 83.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22080-PA 132 GG22080-PA 1..132 1..132 495 89.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20528-PA 131 GH20528-PA 1..131 1..132 473 78.4 Plus
Dgri\GH12746-PA 85 GH12746-PA 1..85 48..132 423 90.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL54-PA 132 CG9353-PA 1..132 1..132 696 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18974-PA 132 GI18974-PA 1..132 1..132 465 75.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10146-PA 132 GL10146-PA 1..132 1..132 441 84.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21722-PA 132 GA21722-PA 1..132 1..132 441 84.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15799-PA 132 GM15799-PA 1..132 1..132 500 93.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22436-PA 132 GJ22436-PA 1..132 1..132 443 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23267-PA 132 GK23267-PA 1..132 1..132 393 78 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12161-PA 132 GE12161-PA 1..132 1..132 487 89.4 Plus

FI06587.hyp Sequence

Translation from 89 to 487

> FI06587.hyp
MTSLTAVFQMARQRLIAPAIGNWARFYAAKPAAPAGKKKKLGKLGPIMEK
KVIPVETDANKLVNYVCGSNYMKTGEDIKIKPDSEYPDWLWTLNTEGIVP
LDELDPNSKQYWRRLRKLALRRNNQLSKLKKF*

FI06587.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL54-PA 132 CG9353-PA 1..132 1..132 696 100 Plus