BDGP Sequence Production Resources |
Search the DGRC for FI06587
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 65 |
Well: | 87 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpL54-RA |
Protein status: | FI06587.pep: gold |
Sequenced Size: | 667 |
Gene | Date | Evidence |
---|---|---|
mRpL54 | 2008-08-15 | Release 5.9 accounting |
mRpL54 | 2008-12-18 | 5.12 accounting |
667 bp assembled on 2008-07-29
GenBank Submission: BT044303.1
> FI06587.complete AAAACGCACAGTTTTGTAAATATCTGTAATTTATCATTTGTTTTTCTATT AAAGTGACGAAAACGGATTAAATAAAGCACATAGCAGACATGACCAGCCT AACCGCAGTTTTCCAGATGGCGAGGCAGCGATTGATAGCCCCAGCGATAG GAAACTGGGCACGTTTTTATGCTGCAAAACCGGCGGCGCCAGCGGGCAAG AAGAAAAAGCTTGGCAAGCTGGGTCCCATCATGGAGAAGAAAGTCATACC CGTGGAAACGGATGCCAACAAATTGGTGAACTATGTATGCGGAAGTAACT ACATGAAAACAGGAGAAGATATCAAAATTAAACCGGATTCGGAATACCCC GACTGGCTGTGGACGCTGAATACGGAAGGCATCGTTCCGCTGGACGAACT GGACCCCAACTCCAAGCAGTACTGGCGCCGTCTGAGGAAACTGGCCTTGC GGCGCAACAATCAGCTGTCCAAGCTAAAGAAGTTCTAGAACCCATAGCCC TAGGTGTTATCGTTGATTTTGGAGACACAGCCGACCGTCACAGCGGCCCA TGTTGTTTGCGATGCTCTCCTGAGCAACAAGTGTGCAAACACCATGTTAT TTTGCTAAAAGCGAATTGCAAATACATTTATTGCACCGTCTTATCATAAA AAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL54-RA | 772 | mRpL54-RA | 85..735 | 1..651 | 3180 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 16947700..16948020 | 327..647 | 1605 | 100 | Plus |
chr2R | 21145070 | chr2R | 16947257..16947448 | 1..192 | 960 | 100 | Plus |
chr2R | 21145070 | chr2R | 16947503..16947639 | 190..326 | 670 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 21061270..21061591 | 330..651 | 1565 | 99.1 | Plus |
2R | 25286936 | 2R | 21060824..21061015 | 1..192 | 960 | 100 | Plus |
2R | 25286936 | 2R | 21061070..21061206 | 190..326 | 670 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 21062469..21062790 | 330..651 | 1565 | 99 | Plus |
2R | 25260384 | 2R | 21062023..21062214 | 1..192 | 960 | 100 | Plus |
2R | 25260384 | 2R | 21062269..21062405 | 190..326 | 670 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy5 | 7369 | gypsy5 GYPSY5 7369bp | 4038..4105 | 639..575 | 106 | 67.6 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 16947257..16947448 | 1..192 | 100 | -> | Plus |
chr2R | 16947506..16947639 | 193..326 | 99 | -> | Plus |
chr2R | 16947700..16948020 | 327..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 1..399 | 90..488 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 1..399 | 90..488 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 1..399 | 90..488 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 1..399 | 90..488 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 1..399 | 90..488 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 1..647 | 1..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 46..692 | 1..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 36..682 | 1..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 1..647 | 1..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL54-RA | 36..682 | 1..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21060824..21061015 | 1..192 | 100 | -> | Plus |
2R | 21061073..21061206 | 193..326 | 99 | -> | Plus |
2R | 21061267..21061587 | 327..647 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21060824..21061015 | 1..192 | 100 | -> | Plus |
2R | 21061073..21061206 | 193..326 | 99 | -> | Plus |
2R | 21061267..21061587 | 327..647 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21060824..21061015 | 1..192 | 100 | -> | Plus |
2R | 21061073..21061206 | 193..326 | 99 | -> | Plus |
2R | 21061267..21061587 | 327..647 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 16948329..16948520 | 1..192 | 100 | -> | Plus |
arm_2R | 16948578..16948711 | 193..326 | 99 | -> | Plus |
arm_2R | 16948772..16949092 | 327..647 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21062466..21062786 | 327..647 | 98 | Plus | |
2R | 21062023..21062214 | 1..192 | 100 | -> | Plus |
2R | 21062272..21062405 | 193..326 | 99 | -> | Plus |
Translation from 89 to 487
> FI06587.pep MTSLTAVFQMARQRLIAPAIGNWARFYAAKPAAPAGKKKKLGKLGPIMEK KVIPVETDANKLVNYVCGSNYMKTGEDIKIKPDSEYPDWLWTLNTEGIVP LDELDPNSKQYWRRLRKLALRRNNQLSKLKKF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11928-PA | 132 | GF11928-PA | 1..132 | 1..132 | 483 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22080-PA | 132 | GG22080-PA | 1..132 | 1..132 | 495 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20528-PA | 131 | GH20528-PA | 1..131 | 1..132 | 473 | 78.4 | Plus |
Dgri\GH12746-PA | 85 | GH12746-PA | 1..85 | 48..132 | 423 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL54-PA | 132 | CG9353-PA | 1..132 | 1..132 | 696 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18974-PA | 132 | GI18974-PA | 1..132 | 1..132 | 465 | 75.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10146-PA | 132 | GL10146-PA | 1..132 | 1..132 | 441 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21722-PA | 132 | GA21722-PA | 1..132 | 1..132 | 441 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15799-PA | 132 | GM15799-PA | 1..132 | 1..132 | 500 | 93.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22436-PA | 132 | GJ22436-PA | 1..132 | 1..132 | 443 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23267-PA | 132 | GK23267-PA | 1..132 | 1..132 | 393 | 78 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12161-PA | 132 | GE12161-PA | 1..132 | 1..132 | 487 | 89.4 | Plus |
Translation from 89 to 487
> FI06587.hyp MTSLTAVFQMARQRLIAPAIGNWARFYAAKPAAPAGKKKKLGKLGPIMEK KVIPVETDANKLVNYVCGSNYMKTGEDIKIKPDSEYPDWLWTLNTEGIVP LDELDPNSKQYWRRLRKLALRRNNQLSKLKKF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL54-PA | 132 | CG9353-PA | 1..132 | 1..132 | 696 | 100 | Plus |