BDGP Sequence Production Resources |
Search the DGRC for FI06805
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 68 |
Well: | 5 |
Vector: | pBS SK- |
Associated Gene/Transcript | Rrp46-RA |
Protein status: | FI06805.pep: gold |
Sequenced Size: | 822 |
Gene | Date | Evidence |
---|---|---|
Rrp46 | 2008-12-18 | 5.12 accounting |
822 bp assembled on 2008-11-04
GenBank Submission: BT050573.1
> FI06805.complete AAATACGAGGCGATAGCACGCGCACGTTGTTTTCTTTGAATATTAGGAAA ATATAATATGAATTTACCAGCGAAAATGGACGTGGAAAAGGATAAGCTTC GCCAGATGCACTGCGAATTCAATCCCTTGTCGCGTTGCGACGGATCCGTG ATGTACAGCCAGGGTGCTACAGGTCTCATAGGCGCAGTTCTCGGCCCCAT CGAGGTGAAGACCCAAAATCTGAGCATAGATGGCAGCTACTTGGAGTGTA ACTACCGACCAAAAGCGGGCCTGCCGCAGGTTACCGATCGGATTCGGGAG GCGGCCATTCGGGATGTGCTGGAACTGGCCCTCCTGTCGGAGGCTCATCC GCGCTCCAAGATGTCCGTGCAGATCCAGGAGCTGGAAGATCGTGGCAGTA TTGATGCCTGCGCCGTAAATTGCGCCTGCCTAGCCATGCTCATCGGAGGC CTGCCTTTAAAGTATAGCTTTGCGGCTGTCCACGCCATCATCAACGAGCA GGGCGAGTATGTGCTAGATCCGGACCAAAGTGAAACCCTCCACCAGCGCG CCAGTTTTACATTCGCCTTTGATTCTGTGGAAGGAAACCTTCTGTTGATC CAGACAAAGGGCTCTTTCAAAATAGCCCAGTTCAATGATATTGAGTGCCT ATGCCTGGCTGCCAGTGCCGAGATCTTTCAGTTCTATCGCAACCAGGTTG CAAAGTATCATGGCAGGAGTGAGGCGACGGCTAAGAAGGAGGACGTCAAT GAGACGTGATGTTAAAACAACTGAAACTACGATTAAAGCTCATTTTATTC TATTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rrp46-RA | 877 | Rrp46-RA | 60..865 | 1..806 | 3970 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 6239550..6239954 | 400..804 | 1995 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 6239255..6239491 | 163..399 | 1170 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 6239028..6239192 | 1..165 | 825 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 10413838..10414244 | 400..806 | 1990 | 99.3 | Plus |
3R | 32079331 | 3R | 10413543..10413779 | 163..399 | 1170 | 99.6 | Plus |
3R | 32079331 | 3R | 10413316..10413480 | 1..165 | 825 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 10154669..10155075 | 400..806 | 1990 | 99.2 | Plus |
3R | 31820162 | 3R | 10154374..10154610 | 163..399 | 1170 | 99.5 | Plus |
3R | 31820162 | 3R | 10154147..10154311 | 1..165 | 825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 6239028..6239190 | 1..163 | 100 | -> | Plus |
chr3R | 6239256..6239491 | 164..399 | 99 | -> | Plus |
chr3R | 6239550..6239954 | 400..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 1..702 | 58..759 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 1..702 | 58..759 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 1..702 | 58..759 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 1..702 | 58..759 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 16..819 | 1..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 16..819 | 1..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 16..819 | 1..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 16..819 | 1..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rrp46-RA | 16..819 | 1..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10413316..10413478 | 1..163 | 100 | -> | Plus |
3R | 10413544..10413779 | 164..399 | 99 | -> | Plus |
3R | 10413838..10414242 | 400..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10413316..10413478 | 1..163 | 100 | -> | Plus |
3R | 10413544..10413779 | 164..399 | 99 | -> | Plus |
3R | 10413838..10414242 | 400..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10413316..10413478 | 1..163 | 100 | -> | Plus |
3R | 10413544..10413779 | 164..399 | 99 | -> | Plus |
3R | 10413838..10414242 | 400..804 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 6239560..6239964 | 400..804 | 99 | Plus | |
arm_3R | 6239038..6239200 | 1..163 | 100 | -> | Plus |
arm_3R | 6239266..6239501 | 164..399 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10154375..10154610 | 164..399 | 99 | -> | Plus |
3R | 10154669..10155073 | 400..804 | 99 | Plus | |
3R | 10154147..10154309 | 1..163 | 100 | -> | Plus |
Translation from 57 to 758
> FI06805.pep MNLPAKMDVEKDKLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEV KTQNLSIDGSYLECNYRPKAGLPQVTDRIREAAIRDVLELALLSEAHPRS KMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKYSFAAVHAIINEQGE YVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDIECLCL AASAEIFQFYRNQVAKYHGRSEATAKKEDVNET*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17467-PA | 234 | GF17467-PA | 1..233 | 1..233 | 1001 | 77.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17562-PA | 226 | GG17562-PA | 1..221 | 7..227 | 1132 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18468-PA | 235 | GH18468-PA | 1..221 | 1..221 | 977 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rrp46-PA | 233 | CG4043-PA | 1..233 | 1..233 | 1197 | 100 | Plus |
Ski6-PB | 246 | CG15481-PB | 22..221 | 13..206 | 150 | 23.8 | Plus |
Ski6-PA | 246 | CG15481-PA | 22..221 | 13..206 | 150 | 23.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24046-PA | 239 | GI24046-PA | 3..225 | 6..225 | 916 | 78.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23700-PA | 234 | GL23700-PA | 1..234 | 1..233 | 989 | 79.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17911-PA | 234 | GA17911-PA | 1..234 | 1..233 | 972 | 77.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23883-PA | 223 | GM23883-PA | 1..222 | 7..228 | 1145 | 96.4 | Plus |
Dsec\GM25757-PA | 246 | GM25757-PA | 22..221 | 13..206 | 142 | 25 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18693-PA | 223 | GD18693-PA | 1..222 | 7..228 | 1135 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23674-PA | 240 | GJ23674-PA | 2..233 | 5..231 | 965 | 82.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11547-PA | 237 | GK11547-PA | 8..232 | 6..232 | 979 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26036-PA | 227 | GE26036-PA | 1..227 | 7..233 | 1146 | 94.3 | Plus |
Translation from 57 to 758
> FI06805.hyp MNLPAKMDVEKDKLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEV KTQNLSIDGSYLECNYRPKAGLPQVTDRIREAAIRDVLELALLSEAHPRS KMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKYSFAAVHAIINEQGE YVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDIECLCL AASAEIFQFYRNQVAKYHGRSEATAKKEDVNET*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rrp46-PA | 233 | CG4043-PA | 1..233 | 1..233 | 1197 | 100 | Plus |
Ski6-PB | 246 | CG15481-PB | 22..221 | 13..206 | 150 | 23.8 | Plus |
Ski6-PA | 246 | CG15481-PA | 22..221 | 13..206 | 150 | 23.8 | Plus |