Clone FI06805 Report

Search the DGRC for FI06805

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:68
Well:5
Vector:pBS SK-
Associated Gene/TranscriptRrp46-RA
Protein status:FI06805.pep: gold
Sequenced Size:822

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rrp46 2008-12-18 5.12 accounting

Clone Sequence Records

FI06805.complete Sequence

822 bp assembled on 2008-11-04

GenBank Submission: BT050573.1

> FI06805.complete
AAATACGAGGCGATAGCACGCGCACGTTGTTTTCTTTGAATATTAGGAAA
ATATAATATGAATTTACCAGCGAAAATGGACGTGGAAAAGGATAAGCTTC
GCCAGATGCACTGCGAATTCAATCCCTTGTCGCGTTGCGACGGATCCGTG
ATGTACAGCCAGGGTGCTACAGGTCTCATAGGCGCAGTTCTCGGCCCCAT
CGAGGTGAAGACCCAAAATCTGAGCATAGATGGCAGCTACTTGGAGTGTA
ACTACCGACCAAAAGCGGGCCTGCCGCAGGTTACCGATCGGATTCGGGAG
GCGGCCATTCGGGATGTGCTGGAACTGGCCCTCCTGTCGGAGGCTCATCC
GCGCTCCAAGATGTCCGTGCAGATCCAGGAGCTGGAAGATCGTGGCAGTA
TTGATGCCTGCGCCGTAAATTGCGCCTGCCTAGCCATGCTCATCGGAGGC
CTGCCTTTAAAGTATAGCTTTGCGGCTGTCCACGCCATCATCAACGAGCA
GGGCGAGTATGTGCTAGATCCGGACCAAAGTGAAACCCTCCACCAGCGCG
CCAGTTTTACATTCGCCTTTGATTCTGTGGAAGGAAACCTTCTGTTGATC
CAGACAAAGGGCTCTTTCAAAATAGCCCAGTTCAATGATATTGAGTGCCT
ATGCCTGGCTGCCAGTGCCGAGATCTTTCAGTTCTATCGCAACCAGGTTG
CAAAGTATCATGGCAGGAGTGAGGCGACGGCTAAGAAGGAGGACGTCAAT
GAGACGTGATGTTAAAACAACTGAAACTACGATTAAAGCTCATTTTATTC
TATTAAAAAAAAAAAAAAAAAA

FI06805.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp46-RA 877 Rrp46-RA 60..865 1..806 3970 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6239550..6239954 400..804 1995 99.5 Plus
chr3R 27901430 chr3R 6239255..6239491 163..399 1170 99.6 Plus
chr3R 27901430 chr3R 6239028..6239192 1..165 825 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10413838..10414244 400..806 1990 99.3 Plus
3R 32079331 3R 10413543..10413779 163..399 1170 99.6 Plus
3R 32079331 3R 10413316..10413480 1..165 825 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10154669..10155075 400..806 1990 99.2 Plus
3R 31820162 3R 10154374..10154610 163..399 1170 99.5 Plus
3R 31820162 3R 10154147..10154311 1..165 825 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:57:13 has no hits.

FI06805.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:58:12 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6239028..6239190 1..163 100 -> Plus
chr3R 6239256..6239491 164..399 99 -> Plus
chr3R 6239550..6239954 400..804 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:45 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 1..702 58..759 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:26 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 1..702 58..759 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:24 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 1..702 58..759 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:52:24 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 1..702 58..759 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:51 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 16..819 1..804 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:25 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 16..819 1..804 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:24 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 16..819 1..804 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 17:31:50 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 16..819 1..804 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:52:24 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp46-RA 16..819 1..804 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:12 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10413316..10413478 1..163 100 -> Plus
3R 10413544..10413779 164..399 99 -> Plus
3R 10413838..10414242 400..804 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:12 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10413316..10413478 1..163 100 -> Plus
3R 10413544..10413779 164..399 99 -> Plus
3R 10413838..10414242 400..804 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:12 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10413316..10413478 1..163 100 -> Plus
3R 10413544..10413779 164..399 99 -> Plus
3R 10413838..10414242 400..804 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:24 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6239560..6239964 400..804 99   Plus
arm_3R 6239038..6239200 1..163 100 -> Plus
arm_3R 6239266..6239501 164..399 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:38 Download gff for FI06805.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10154375..10154610 164..399 99 -> Plus
3R 10154669..10155073 400..804 99   Plus
3R 10154147..10154309 1..163 100 -> Plus

FI06805.pep Sequence

Translation from 57 to 758

> FI06805.pep
MNLPAKMDVEKDKLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEV
KTQNLSIDGSYLECNYRPKAGLPQVTDRIREAAIRDVLELALLSEAHPRS
KMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKYSFAAVHAIINEQGE
YVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDIECLCL
AASAEIFQFYRNQVAKYHGRSEATAKKEDVNET*

FI06805.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17467-PA 234 GF17467-PA 1..233 1..233 1001 77.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17562-PA 226 GG17562-PA 1..221 7..227 1132 94.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18468-PA 235 GH18468-PA 1..221 1..221 977 81 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp46-PA 233 CG4043-PA 1..233 1..233 1197 100 Plus
Ski6-PB 246 CG15481-PB 22..221 13..206 150 23.8 Plus
Ski6-PA 246 CG15481-PA 22..221 13..206 150 23.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24046-PA 239 GI24046-PA 3..225 6..225 916 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23700-PA 234 GL23700-PA 1..234 1..233 989 79.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17911-PA 234 GA17911-PA 1..234 1..233 972 77.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23883-PA 223 GM23883-PA 1..222 7..228 1145 96.4 Plus
Dsec\GM25757-PA 246 GM25757-PA 22..221 13..206 142 25 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18693-PA 223 GD18693-PA 1..222 7..228 1135 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23674-PA 240 GJ23674-PA 2..233 5..231 965 82.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11547-PA 237 GK11547-PA 8..232 6..232 979 79.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26036-PA 227 GE26036-PA 1..227 7..233 1146 94.3 Plus

FI06805.hyp Sequence

Translation from 57 to 758

> FI06805.hyp
MNLPAKMDVEKDKLRQMHCEFNPLSRCDGSVMYSQGATGLIGAVLGPIEV
KTQNLSIDGSYLECNYRPKAGLPQVTDRIREAAIRDVLELALLSEAHPRS
KMSVQIQELEDRGSIDACAVNCACLAMLIGGLPLKYSFAAVHAIINEQGE
YVLDPDQSETLHQRASFTFAFDSVEGNLLLIQTKGSFKIAQFNDIECLCL
AASAEIFQFYRNQVAKYHGRSEATAKKEDVNET*

FI06805.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp46-PA 233 CG4043-PA 1..233 1..233 1197 100 Plus
Ski6-PB 246 CG15481-PB 22..221 13..206 150 23.8 Plus
Ski6-PA 246 CG15481-PA 22..221 13..206 150 23.8 Plus