Clone FI06809 Report

Search the DGRC for FI06809

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:68
Well:9
Vector:pBS SK-
Associated Gene/TranscriptGalt-RA
Protein status:FI06809.pep: gold
Sequenced Size:1455

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9232 2008-12-18 5.12 accounting

Clone Sequence Records

FI06809.complete Sequence

1455 bp assembled on 2008-11-04

GenBank Submission: BT058003.1

> FI06809.complete
AGATAAGGCTGATGGAAAATTCTTCCACTGAAAGGCGGAATGCGTGCCAA
ACTCAAACTAAACGCTCGCCGGCAGAGTGTGCGGAATAATCCGAAGAGAG
AAAAGAGAGGAATGTAGCTGAAGAAGCGCGCTTTGCTAAGCGAAAAACAG
CTCAACTGGAATCGGATTCAGAAGCAAAAGCAGAATCACAATCGGAACAC
CAATATCAGCAGCATTAGGAGCTGTAATCGCAACGCGGCAGGTTGACATT
GGGCTTGTCCCGTGAATCTGAAGTAGTCATAATCCGATCGGAGTGATACG
GAGCGCCAGTCTTTCGACACGATGCAGTTTGTGGCCAGTGAGCACCCGCA
CCGACGTCTAAATCCGTTGAACGGCCAATGGGTCCTAGTGTGCCCACATC
GCACCCAACGCCCTTGGTCGGGTCAGCAGGAGAAGGCGCAGAAGAACGAG
CTGCCCGAATTCGATCCCACCAATCCTCTGTGCCCTGGCGTCACCAGACC
CAATGGAATCCAAACTCCGGAATATGAGAGCACCTATGTGTTTGAGAACG
ACTTCCCGGCCCTGGTGGAGGTGGTGCCCGTTCCGCCCAACAACGATGAT
CCACTGTTCCAGATAGCTCCCGCCCGTGGCAACTGCCGAGTGATGTGCTT
CCATCCCAAATCGAATCTGACTTTGCCCACGATGAGTGCAGCGGAAATCG
TCGTTGTTATCGACGAGTGGATCAGCCAGTTCAACGAGCTTAGCGCCAAG
TACGCGTGGGTGCAGATATTCGAGAACAAGGGAGCCGCCATGGGGTGTTC
CAATCCCCATCCGCACTGCCAGATCTGGTCATGCTCGTTTCTGCCGACGG
AACCGCAACTGAAGCAGGAGCGTCTGCGTGCCTACTACGCCACCAACGAG
CGGCCCATGCTGGCCGACTATGTGGAGCGTGAGCTGCAGCGCCAGGAGCG
GATTGTCATTGAGAATCGCGACTGGTTGGTGGTGGTGCCCTTCTGGGCCA
CTTGGCCCTTCGAAACCATGCTCATCTCACGCAACAACAATAAGCGGATC
AATGATCTTACCGCAGAACAGCGATACAACTTGGCGCTGACCATAAAGGA
GCTGACCACCAAGTATGACAATCTGTTCCAGTGTTCATTCCCCTACTCGA
TGGGTTGGCATGGAGCACCGACTGGGCCGGAGCATGCCCACGCATCCAGT
GCTCATTGGACCCTGCACGCCATCTACTATCCGCCGCTGCTTCGTTCTGC
CTCCGTGCGCAAGTTCATGGTGGGATTTGAGCTGCTGGCCATGGCCCAGC
GGGATCTGACTCCCGAACAGGCAGCCCAAAGGTTGCGGGAGGTCGATGGA
AAGTGTCATTATCTAGAGAAGTGATTTCGCTCGAGGGTATTTGTAGAATC
CCAGATGGTTTAGAATTCAATAAAAAAAAGGAGTCTAAAAAAAAAAAAAA
AAAAA

FI06809.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9232-RA 1558 CG9232-RA 85..1522 1..1438 7115 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6665361..6666069 1425..717 3515 99.7 Minus
chr2L 23010047 chr2L 6666731..6667070 340..1 1685 99.7 Minus
chr2L 23010047 chr2L 6666144..6666351 718..511 1040 100 Minus
chr2L 23010047 chr2L 6666421..6666591 510..340 855 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6666287..6667008 1438..717 3550 99.4 Minus
2L 23513712 2L 6667671..6668010 340..1 1685 99.7 Minus
2L 23513712 2L 6667084..6667291 718..511 1040 100 Minus
2L 23513712 2L 6667361..6667531 510..340 855 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6666287..6667008 1438..717 3550 99.4 Minus
2L 23513712 2L 6667671..6668010 340..1 1685 99.7 Minus
2L 23513712 2L 6667084..6667291 718..511 1040 100 Minus
2L 23513712 2L 6667361..6667531 510..340 855 100 Minus
Blast to na_custom.ecoli performed 2008-11-04 17:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
E. 2070 E. 1819..1865 1114..1160 145 87.2 Plus
E. 2070 E. 1921..2018 1228..1325 145 76.5 Plus
Escherichia 14358 Escherichia 10252..10298 1160..1114 145 87.2 Minus
Escherichia 14358 Escherichia 10099..10196 1325..1228 145 76.5 Minus
Escherichia 10183 Escherichia 5338..5384 1160..1114 145 87.2 Minus
Escherichia 10183 Escherichia 5185..5282 1325..1228 145 76.5 Minus
Blast to na_te.dros performed on 2019-03-15 16:58:34 has no hits.

FI06809.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:59:18 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6666146..6666351 511..716 100 <- Minus
chr2L 6666421..6666590 341..510 100 <- Minus
chr2L 6665350..6666069 717..1436 99 <- Minus
chr2L 6666731..6667070 1..340 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:48 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
CG9232-RA 1..1053 322..1374 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:06 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
CG9232-RA 1..1053 322..1374 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:07 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
Galt-RA 1..1053 322..1374 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:30 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
Galt-RA 1..1053 322..1374 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:59:48 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
CG9232-RA 22..1457 1..1436 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:06 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
CG9232-RA 22..1457 1..1436 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:07 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
Galt-RA 24..1459 1..1436 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 17:43:50 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
CG9232-RA 22..1457 1..1436 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:30 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
Galt-RA 24..1459 1..1436 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:18 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6666289..6667008 717..1436 99 <- Minus
2L 6667086..6667291 511..716 100 <- Minus
2L 6667361..6667530 341..510 100 <- Minus
2L 6667671..6668010 1..340 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:18 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6666289..6667008 717..1436 99 <- Minus
2L 6667086..6667291 511..716 100 <- Minus
2L 6667361..6667530 341..510 100 <- Minus
2L 6667671..6668010 1..340 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:18 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6666289..6667008 717..1436 99 <- Minus
2L 6667086..6667291 511..716 100 <- Minus
2L 6667361..6667530 341..510 100 <- Minus
2L 6667671..6668010 1..340 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:07 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6666289..6667008 717..1436 99 <- Minus
arm_2L 6667086..6667291 511..716 100 <- Minus
arm_2L 6667361..6667530 341..510 100 <- Minus
arm_2L 6667671..6668010 1..340 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:24 Download gff for FI06809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6666289..6667008 717..1436 99 <- Minus
2L 6667086..6667291 511..716 100 <- Minus
2L 6667361..6667530 341..510 100 <- Minus
2L 6667671..6668010 1..340 99   Minus

FI06809.hyp Sequence

Translation from 321 to 1373

> FI06809.hyp
MQFVASEHPHRRLNPLNGQWVLVCPHRTQRPWSGQQEKAQKNELPEFDPT
NPLCPGVTRPNGIQTPEYESTYVFENDFPALVEVVPVPPNNDDPLFQIAP
ARGNCRVMCFHPKSNLTLPTMSAAEIVVVIDEWISQFNELSAKYAWVQIF
ENKGAAMGCSNPHPHCQIWSCSFLPTEPQLKQERLRAYYATNERPMLADY
VERELQRQERIVIENRDWLVVVPFWATWPFETMLISRNNNKRINDLTAEQ
RYNLALTIKELTTKYDNLFQCSFPYSMGWHGAPTGPEHAHASSAHWTLHA
IYYPPLLRSASVRKFMVGFELLAMAQRDLTPEQAAQRLREVDGKCHYLEK
*

FI06809.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Galt-PB 350 CG9232-PB 1..350 1..350 1918 100 Plus
Galt-PA 350 CG9232-PA 1..350 1..350 1918 100 Plus

FI06809.pep Sequence

Translation from 321 to 1373

> FI06809.pep
MQFVASEHPHRRLNPLNGQWVLVCPHRTQRPWSGQQEKAQKNELPEFDPT
NPLCPGVTRPNGIQTPEYESTYVFENDFPALVEVVPVPPNNDDPLFQIAP
ARGNCRVMCFHPKSNLTLPTMSAAEIVVVIDEWISQFNELSAKYAWVQIF
ENKGAAMGCSNPHPHCQIWSCSFLPTEPQLKQERLRAYYATNERPMLADY
VERELQRQERIVIENRDWLVVVPFWATWPFETMLISRNNNKRINDLTAEQ
RYNLALTIKELTTKYDNLFQCSFPYSMGWHGAPTGPEHAHASSAHWTLHA
IYYPPLLRSASVRKFMVGFELLAMAQRDLTPEQAAQRLREVDGKCHYLEK
*

FI06809.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14459-PA 350 GF14459-PA 1..350 1..350 1768 92.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23600-PA 350 GG23600-PA 1..350 1..350 1842 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13576-PA 350 GH13576-PA 1..350 1..350 1635 85.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Galt-PB 350 CG9232-PB 1..350 1..350 1918 100 Plus
Galt-PA 350 CG9232-PA 1..350 1..350 1918 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24150-PA 350 GI24150-PA 1..350 1..350 1651 86.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25591-PA 250 GL25591-PA 1..143 1..143 710 90.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21629-PA 350 GA21629-PA 1..350 1..350 1791 92.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14012-PA 350 GM14012-PA 1..350 1..350 1878 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22556-PA 350 GD22556-PA 1..350 1..350 1881 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21423-PA 350 GJ21423-PA 1..350 1..350 1660 87.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18097-PA 356 GK18097-PA 1..350 1..350 1703 87.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18419-PA 350 GE18419-PA 1..350 1..350 1862 97.4 Plus